KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_06420
Entry
PA14_06420        CDS       T00401                                 

Definition
(GenBank) putative lactam utilization protein
  KO
K07160  5-oxoprolinase (ATP-hydrolysing) subunit A [EC:3.5.2.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00480  Glutathione metabolism
pau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA14_06420
Enzymes [BR:pau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     PA14_06420
SSDB
Motif
Pfam: LamB_YcsF
Other DBs
NCBI-ProteinID: ABJ15457
UniProt: A0A0H2ZKC5
Position
564699..565457
AA seq 252 aa
MTEVDFNSDMGEGFGPWTIGDGVDAAIMPLISSANIATGFHAGDPSSMRRTVEMAAEHGV
AIGAHPGFRDLVGFGRRHIAAPAIELVNDMLYQLGALREFARLQGLSLQHVKPHGALYMH
LARDEAAARLFVETLQRLEPELLLYCMPGSATWRIGRELGQPLVREFYADRDYDRSGSIV
FTRRVAALDPQQVADKVLRACREGKVRTVEGEDLDIAFDSVCIHSDTPGALELVASTRAR
LEGAGIRIKAPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgactgaagtcgacttcaattccgacatgggcgaaggcttcggcccatggaccatcggc
gatggcgtggatgccgcgatcatgccgctgatcagcagcgccaacatcgccaccggtttc
catgccggcgacccgagcagcatgcgccgcaccgtggagatggccgccgagcatggcgtg
gccatcggcgcccatccgggcttccgcgacctggtcggcttcggtcgccggcacatcgcc
gcgccggccatcgagctggtcaacgacatgctctaccagcttggcgccctgcgcgaattc
gcccggctgcagggcctgtcgctgcaacacgtcaagccccacggcgcgctctacatgcac
ctggcgcgcgacgaggccgccgcgcgcctgttcgtcgagaccctgcaacgcctggaaccg
gaactgctgctctattgcatgcccggttcggccacctggcgcatcggtcgggaactgggc
cagccgctggtgcgcgagttctacgccgaccgcgactacgaccgtagcggctccatcgtc
ttcacccggcgggtcgccgccctcgatccgcaacaggtcgccgacaaggtcctgcgcgcc
tgccgcgagggcaaggtgcgcaccgtcgagggcgaggacctcgacatcgccttcgactcg
gtgtgcatccacagcgacacccccggcgccctggagctggtcgccagcacccgcgcgcgc
ctggaaggcgccggcatccgcatcaaggcgccgcgttga

DBGET integrated database retrieval system