KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_10900Help
Entry
PA14_10900        CDS       T00401                                 

Gene name
ydjL
Definition
(GenBank) putative Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PA14_10900 (ydjL)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PA14_10900 (ydjL)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PA14_10900 (ydjL)
    1.1.1.-  
     PA14_10900 (ydjL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: ABJ13372
UniProt: A0A0H2ZFZ6
Position
complement(942715..943773)
Genome map
AA seq 352 aa AA seqDB search
MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLS
GCRAPLTLGHEFCGVVAALGPGVEGLRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFI
GLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGL
GPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDC
AFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPEL
IALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQVKVLVNPNPALADA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgctggcacgccgcccgcgacctccgcctgagcgaactggaacgccag
gcgccgcggcccggcgaagtcgaactggaagtcgcctactgcggcatctgcggcagcgac
ctgcacgaataccagagcggcccgcactcgattccccaggccgaggcgcacccgctgtcc
ggttgccgcgcgccgctgaccctcggccatgagttctgcggcgtggtcgccgcgctcggc
cctggcgtggagggactgcgcatcggcgaccgcgtcgcggtggagccggaataccgctgc
ggcgaatgccgctactgccgggaaggccgctacaacctctgcgagtcgatgggcttcatc
ggcctgatgggcgacggcggcttcgccgagcgcgcgcgggtgccggcctacatgctgcac
cgcctgccggacgcggtgggcttccgccaggccgccgtgctcgaaccggccgccgtggcc
ctgcacgcgctgcgccgcagcagcctggcgccgggccagcgctgcgcggtgttcgggctc
ggcccgatcggtctgctgctggtgatgctcgcccgcctgcgcggaatcgaggacatcgcc
gcggtcgacgtcagtcccgagcgcctcgccctggccggcgaattcggcgccagccgggcg
ctcgacgcccgtgacggcgacacggcggcgcgcctgcgcgaaggcggcgcgctcgattgc
gccttcgaggccgccggcagccaggccagcctcgacgccgccctggccagcctgcgcaag
ggtggcgagctggtgctggtgagcctgatgggcgaggtcaggctggacgccttcgacctg
gtcaaccgcgaactgcgcctgctcggcagcgtcggctaccgcgacgcctacccggagctg
atcgccctgctcgccgatggccgcctcgacctggcccgcgcagtgacccgcagcgtgccc
ctggagcaggccgtcgagcacggtttcgaggccctgctgcgcgacaagtcgcaggtcaag
gtgctggtcaatcccaacccggccctggccgacgcctga

DBGET integrated database retrieval system