KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_18970
Entry
PA14_18970        CDS       T00401                                 

Gene name
pldA
Definition
(GenBank) phospholipase D
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: PLDc PLDc_2 FokI_C
Other DBs
NCBI-ProteinID: ABJ12740
UniProt: A0A0H2ZD79
Position
complement(1635662..1638973)
AA seq 1103 aa
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDY
FSDLASALDSALDSASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWL
SPSGSLGTYDFETMLAVFQLNAGLEGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNR
IGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNPGLPHLGWMAEDEHVSSMGLMMATLFD
LSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALNGAAYLSDLFRSPMLPS
LQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPELERRLRA
WLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELA
GSLFWTLHRLLQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPS
VYDLARNFIDRWNGQQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRN
LRLELDPPTPCWINAPEQLPQEPEVRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQ
VGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFFQSEFGKEGEVFKDLPLSGPMASLRDV
GSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQFLKSMLAMWGVNAQGWL
THKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMHQVHLTQ
QSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLN
LRTWAVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPL
TVRLDGKNDAIVGKAIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAI
QTLAKENTRAYERTFNFIPQNISQTQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAG
GQLMEPMPYQEIFWRSSNLTSVKTFPPPNGVSGFITALPTSWTRGERNDSGLNLSILAHQ
DSRSLPTQVAMNGDSSAQGKHRT
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgttgcagaagaagccctacaacggcctccacgaaaaggaactcaaccagatcaaccag
caggatggcagcccctgcgtagccatttccgcaccgggctgtttcatcaaggggtccaac
ctcttttccgaaaagcgggccggtaaccgggtccgcttcttcaccaccggccgggactac
ttcagcgacctggccagcgccctcgacagcgccctcgacagcgccagttcgagcatcttc
atcaccggctggcaggtcaactacgacgtcctcctcgacggccgccgcagcctctggcag
tgcctgcgccaggcgctggagcgctcgcccgcgctgaaggtctacgtgatgccctggctc
agcccttccggcagcctcggcacctatgacttcgaaaccatgctcgcggtgttccagctc
aacgccggactcgagggcggcgcgcgcgccttctgtacgccggcgatccagcagagcgac
atgcagggactgggcgtcgccttctcccaccaccagaaatccgtggtgatcgacaaccgc
atcggctatgtcggcgggatcgaccttgcctatggccgtcgcgacgacaacgatttcagc
ctcgacgcctccgggcgccggggcaacgacgcctataatcccggcctaccgcatcttggc
tggatggcggaggacgaacacgtcagctccatgggcctgatgatggccaccctgttcgac
ctttccaggccgctcgccagcctgacgctgcatgcgcccacccttcgcctgtcgcccttc
ccgcacatcgccgccagcgacgaaccgctgctgagcattcccctcgcacccagccgcgcc
cgcgccctcaacggcgccgcctacctttccgacctgttccgcagcccgatgctgccctcc
ctgcaatggctcggccgcgcctacaacagctcgaaagaaggcctggacgaaggcttcgaa
cggctcgatgcgctcaggcggcagatggtcgccagcagcatccgcgccattgccaacctg
atcgccgacaacctcgacgccctgcccatcgagcctgaactcgaacgccgcctgcgcgcc
tggctggaggaactgcgcacggccgcgctcaacctgccggaagccctgcggatcaagagc
ctgctcctgatcaaccagtggatgagcgaaaccgaactgggccaggtcctgaccctgatc
agcggcaagggcttcgaagatatcccgcagaacctgagcggcaaggccggcgagttggcc
ggctcgctgttctggacactccacaggctgttgcaggcccgcgccggaggccaccagcaa
ccctatcgctacctggacgaagcgcctcagccattggcctcgccggacaacgcccggctg
gccgccgaccagccgcgcatgccctggcaggatgtgcattgccgcatcgaagggccgtcg
gtgtacgacctggcgcgcaacttcatcgaccgctggaacggccagcaggcctacctggcc
aagacgccggcgctacaggatacggcgctggtacgcagcgccctggaagccgtgatgaag
tggctgaacagcctggccgccgccgcgggattggagaactacctggacgagaagcgcaac
ctccggctcgaactggacccacccacgccctgctggatcaacgcgccggaacagttgccg
caagagccggaggtgcgccgcggcggcatgaccgtacaggtactgcgcagcgccgcggcg
cgcatgctcgaacaggagcaggccggccgcctcggcgcgggagtgaacctgcccttgcag
gtcggcgtctccaccgaaggagtccagagcaactgcaaggacgccatgctcctggcgatt
tccggggcgcagcagttcatctatatcgagaaccagttcttccagagcgagttcggcaag
gaaggcgaagttttcaaggatctgcccctttcaggccccatggccagtctgcgcgacgtt
ggcagcctgcgacgcgacttcgtcgtccggatacgcttggaggaagccctggagcagcgc
gacctctggctgctggactgggccgaagtggagaagatcgcccaggagcctggcaccgag
gcccgccagttcctcaagtcgatgctcgccatgtggggcgtgaacgcccagggctggctc
acccacaagctcggcgaggcccagcacggcctgctcaacgagatcggcgaagccctggcg
cggcgcatcgaacgggccatccagcgcgagcacccgttccacgtctacctggtcctgccg
gtgcacccggagggcgcgctgaacgtgccgaacatcatgcaccaggtgcacctgacccag
cagagcctggtgttcggcgaacagagcctggtcaagcgcattcagcggcagatggcgctc
aaggccctggaaggcaagtccgacccggcccaggcccgggaaatcatcgagcgcaaggac
gctcgcggtcgcccggtctacgaacagcaggactggagccgctacctgaccctgctcaac
ctgcgcacctgggcggtgctcggcgggcgggtggtcaccgaacagatctacgtgcacagc
aagctgctgatcgccgacgaccgggtggccatcctcggcagcgccaatatcaacgaccgc
agcctgcaaggcgagcgcgactccgagctggcggtgatggtgcgcgacagcgagccgctg
acggtcaggctggacggcaagaacgacgccatcgtcggcaaggccatccaccagttgcgg
gtgaatttgtggaagaagcattttggcttgagccaggggccaggcggtttcgtcaagccg
gccagcgagttgagtgcttatctgtccatcccggcggctcaagaggcctgggaagctata
caaacattagccaaggagaatactcgtgcctatgaacggactttcaattttattccccaa
aatatcagccagactcaactgcaactgactccagagccgcctaaaggatttgaggacgga
tttcccgcctccatatggccaacctgggcatacagaaaacctggcgagttaagggcgggc
ggacaactgatggagccgatgccatatcaggaaatcttctggcgctcatctaatctcact
tcggtgaaaaccttcccaccacccaacggggtttccggtttcatcacggctctaccaacc
agttggacccgtggtgagcgcaatgattctggcttgaatctaagcatcctggcacatcag
gacagcagatcgcttcccacccaggtcgccatgaatggagatagctcggcacaaggaaag
catcgcacatga

DBGET integrated database retrieval system