KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19010Help
Entry
PA14_19010        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABJ12739
UniProt: A0A0H2ZEH3
Structure
PDB: 

Position
complement(1641698..1642135)
Genome map
AA seq 145 aa AA seqDB search
MKTVALFLASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLR
NPRQLEVQRQDAPPSPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVS
ASEQSEDGEPTFALAWALLERARLQ
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagtcgccctgtttctcgccagcctcgccctgctggcctgcaccgcggagtcc
ggggtggacttcgacaagaccctgacccacccgaacggcctggtggtggagcgccccgtc
ggcttcgacgcgcggcgcagcgccgagggcttccgcttcgacgaaggcggcaagctgcgc
aacccacgccaactggaggtccagcgccaggacgcgccgccctcgcccgacctggcgagc
aggcgtctgggcgacggcgaggcgcgctacaaggtagaggaagacgacggcggctccgca
ggcagcgaataccgcctgtgggcagccaagccggcgggcgcgcggtggatcgtggtcagc
gccagcgagcagagcgaggatggcgaaccgaccttcgccctggcctgggcgctgctggag
cgggccaggttgcaatag

DBGET integrated database retrieval system