KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19020Help
Entry
PA14_19020        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABJ12738
UniProt: A0A0H2ZEF1
Structure
PDB: 

Position
complement(1642132..1643358)
Genome map
AA seq 408 aa AA seqDB search
MTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVG
PPELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLAD
AAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPADLPSIAFGDQLKLLNKDPATVTKYS
NPLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTP
QLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPV
RRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGN
PRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLDPGMRFP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccagcgacctgatcgagtcactgatttcctatagctgggacgactggcag
gtgacccgccaggaagcccgccgggtgatcgccgcgatccgcaacgacaacgtgcccgat
gcgaccatcgccgcactcgacaagagcggctcgctgatcaagctgttccagcgggtgggc
ccgccggaactggcgcgctcgctgatcgccagcatcgccgggcgcaccaccatgcagcgc
taccaggcacgcaatgccttgatccgcagcctgatcaacaatcccctgggcacccagacc
gacaactggatctacttccccaccatcaccttcttcgacatctgcgccgacctcgccgac
gccgctggccgcctgggcttcgccgcggccggcgccaccggggtggccagccaggcgatc
cagggtccgttcagcggggtcggcgccaccggcgtcaatccggccgacctgccgtccatt
gccttcggcgaccagctcaagctgctcaacaaggacccggcgaccgtcaccaagtacagc
aacccgctcggcgacctgggcgcctacctgagccagctttcgccgcaagacaagctgaac
caggcacagacgctggtcggccagccgatcagcacgctgttccccgacgcctatccgggc
aacccgccgtcgcgggccaaggtcatgtccgcggctgcgcgcaagtacgacctgacgccg
caactgatcggcgcgatcatcctcgccgagcagcgtgaccagacccgcgacgaagacgcc
aaggactatcaggcggcagtcagcatcaagagcgccaacacctccatcggcctcggccag
gtggtggtctccaccgcgatcaagtacgagctgttcaccgacctgctcggccagccggtg
cgccgcggcctgtcgcgcaaggcggtcgccaccctgctggcttccgacgaattcaacatc
ttcgccaccgcccgttacatccgctacgtcgccaacctggcgtcgcaacaggacctgcgc
aagttgccgaagacccgcggtgcatttccctccatcgatctccgcgcctacgccggcaat
ccgcgcaactggccgcgggacaatgtccgcgcgctggcctcggaatacacctcgcgtccc
tgggacgacaacctgtcgccgggctggccgatgttcgtcgacgatgcctacgccaccttc
ctcgaccctggaatgaggttcccatga

DBGET integrated database retrieval system