KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19050Help
Entry
PA14_19050        CDS       T00401                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00450  Selenocompound metabolism
pau00970  Aminoacyl-tRNA biosynthesis
pau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PA14_19050 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PA14_19050 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pau01007]
    PA14_19050 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pau03016]
    PA14_19050 (metG)
Enzymes [BR:pau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PA14_19050 (metG)
Amino acid related enzymes [BR:pau01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PA14_19050 (metG)
Transfer RNA biogenesis [BR:pau03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PA14_19050 (metG)
 Prokaryotic type
   Other AARSs
    PA14_19050 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABJ12736
UniProt: Q02QX1
Position
complement(1644279..1646315)
Genome map
AA seq 678 aa AA seqDB search
MSEPRKILVTSALPYANGSIHLGHMLEYIQTDMWVRFQKMRGNQAVYVCADDAHGSAIML
RAEREGITSEQLIDAVRAEHMGDFADFLVDFDNYHSTHSEENRELSSAIYLKLRDAGHID
TRPVTQYFDPEKQMFLADRFIKGTCPKCGTADQYGDNCEACGATYAPTELKDPKSAISGA
TPVLKESLHYFFKLPDFEAMLKQWTRSGALQESVANKLAEWLDSGLQQWDISRDAPYFGF
EIPDAPGKYFYVWLDAPIGYMASFKNLCARRPELDFDAFWGKDSSAELYHFIGKDIVNFH
ALFWPAMLEGAGYRKPTALNVHGYLTVNGQKMSKSRGTFVKARTYLDHLDPEYLRYYYAS
KLGRGVEDLDLNLEDFVQKVNSDLVGKVVNIASRCAGFIHKGNAGVLVGADPAPELLAAF
REAAPGIAEAYEARDFNRAMREIMALADRANAWIAEQAPWALAKQEGQQDKVQAVCGLGI
NLFRQLVIFLKPVLPKLAAAAEAFLNVAPLTWADHRTLLANHQLNPFQPLMTRIEPAKVE
AMIEASKEDLAAAASQPAGNGELVKEPIAAEIDFDAFAAVDLRIALIEKCEFVEGADKLL
RLSLDIGDAKRNVFSGIKSAYPDPSALEGRLTLYVANLAPRKMKFGVSEGMVLAAGPGGE
EIYLLSPDSGAKPGQRVK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaccacgcaagatcctcgttaccagcgccctcccctacgccaacggttccatt
cacctgggacacatgctggagtacatccagacggacatgtgggtgcgcttccagaagatg
cgtggcaaccaggccgtctacgtctgcgccgacgacgcccacggttcggcgatcatgctc
cgcgccgagcgcgagggcatcacctccgagcaactgatcgacgccgtgcgcgccgagcac
atgggcgacttcgccgacttcctggtggacttcgacaactaccactcgacccactcggaa
gagaaccgcgagctgtccagcgcgatctacctgaaactgcgcgacgccgggcacatcgac
acccgcccggtgacccagtacttcgacccggaaaagcagatgttcctcgccgaccgcttc
atcaagggcacctgcccgaagtgcggcaccgccgaccagtacggcgacaactgcgaggcc
tgcggcgcgacctacgccccgaccgaactgaaggacccgaaatcggcgatctccggcgcc
accccggtgctcaaggaatcgctgcactacttcttcaagctgccggacttcgaggccatg
ctcaagcaatggacccgcagcggcgcccttcaggagtcggtggccaacaagctcgccgag
tggctggacagcggcctccagcagtgggacatctcgcgcgacgcgccgtacttcggcttc
gagattcccgacgctcccggcaagtacttctacgtctggctggacgcgccgatcggctac
atggccagcttcaagaacctctgcgcgcggcgtcccgagctggacttcgacgcgttctgg
ggcaaggactccagtgccgagctgtaccacttcatcggcaaggacatcgtcaacttccac
gcgctgttctggccggccatgctcgaaggcgccggctaccgcaagccgaccgcgctgaac
gtgcacggctacctgaccgtgaacggccagaagatgtccaagtcgcgcggcaccttcgtc
aaggcgcgcacctacctcgaccacctggacccggaatacctgcgctactactacgcctcc
aagctcggccgcggcgtcgaggacctcgacctgaacctcgaggacttcgtgcagaaggtc
aactccgacctggtcggcaaggtcgtcaacatcgccagccgctgcgccggcttcatccac
aagggcaacgccggcgtgctggtcggcgccgatcctgcgccggagctgctcgccgccttc
cgcgaggccgcaccgggcatcgccgaggcctatgaggcccgcgacttcaatcgcgccatg
cgcgagatcatggccctcgccgaccgcgccaacgcctggatcgccgaacaggcgccctgg
gcgctggccaagcaggaaggccagcaggacaaggtccaggccgtctgcggcctgggcatc
aacctgttccgccagttggtgatcttcctcaagccggtgctgccgaagctggccgccgcc
gccgaagccttcctcaacgtcgccccgctgacctgggccgaccaccggaccctgctggcc
aaccaccaactgaacccgttccagcccctgatgacccgtatcgagcccgcgaaagtagaa
gccatgatcgaagcctccaaggaagacctcgccgccgccgcatcccaacccgccggcaac
ggcgagctggtcaaggaacccatcgccgcggagatcgacttcgacgctttcgccgcggtc
gacctgcgcatcgccctgatcgagaagtgcgagttcgtcgaaggcgccgacaagctgctg
cgcctgtcgctggacatcggcgacgcgaagcgtaacgtgttctccgggatcaagagcgcg
tatcccgacccgagcgccctggaaggccgcctgacgctctatgtggccaacctggcgccg
cgcaagatgaagttcggggtgtccgagggcatggtcctggccgccggcccgggtggcgag
gagatctacctgctgagtccggacagcggcgccaagccgggccagcgcgtcaagtaa

DBGET integrated database retrieval system