KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19630Help
Entry
PA14_19630        CDS       T00401                                 

Gene name
folE1
Definition
(GenBank) GTP cyclohydrolase I precursor
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00790  Folate biosynthesis
pau01100  Metabolic pathways
Module
pau_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA14_19630 (folE1)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PA14_19630 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DAO_C MAPKK1_Int F_bP_aldolase QueF
Motif
Other DBs
NCBI-ProteinID: ABJ12693
UniProt: A0A0H2ZE35
Position
complement(1694715..1695275)
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcattaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgacaccccgaagcgcgcggccaaggccatgcagtacctctgc
cacggctatggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gatgaaatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccacctcctg
cccttcatcggcaaggctcatgtggcgtacattcccaccggcaaggtgctcggcctgtcg
aaggtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgccggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgactcgaacaccacccgccaggaatttctgcaa
ttgatcggaaggagcaagtga

DBGET integrated database retrieval system