KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_23970Help
Entry
PA14_23970        CDS       T00401                                 

Gene name
xcpQ
Definition
(GenBank) general secretion pathway protein D
  KO
K02453  general secretion pathway protein D
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_23970 (xcpQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_23970 (xcpQ)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_23970 (xcpQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin Secretin_N
Motif
Other DBs
NCBI-ProteinID: ABJ12337
UniProt: A0A0H2ZDH6
Structure
PDB: 

Position
complement(2081960..2083936)
Genome map
AA seq 658 aa AA seqDB search
MSQPLLRALFAPSSRSYVPAVLLSLALGIQAAHAENSGGNAFVPAGNQQEAHWTINLKDA
DIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGD
QARIVPNAEAKTEAGGGQSAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSAN
ALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAG
AQVIADARTNRLIILGPPQARAKLVQLAQSLDTPTARSANTRVIRLRHNDAKTLAETLGQ
ISEGMKNNGGQGGEQTGGGRPSNILIRADESTNALVLLADPDTVNALEDIVRQLDVPRAQ
VLVEAAIVEISGDIQDAVGVQWAINKGGMGGTKTNFANTGLSIGTLLQSLESNKAPESIP
DGAIVGIGSSSFGALVTALSANTKSNLLSTPSLLTLDNQKAEILVGQNVPFQTGSYTTNS
EGSSNPFTTVERKDIGVSLKVTPHINDGAALRLEIEQEISALLPNAQQRNNTDLITSKRS
IKSTILAENGQVIVIGGLIQDDVSQAESKVPLLGDIPFLGRLFRSTKDTHTKRNLMVFLR
PTVVRDSAGLAALSGKKYSDIRVIDGTRGPEGRPSILPTNANQLFDGQAVDLRELKTE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacctttgctccgcgccctgtttgccccttccagtcgttcgtacgttcccgcc
gtccttctcagcctggccctcggcatccaggcggcgcacgccgaaaacagcggcgggaac
gccttcgtcccggccggcaaccagcaggaggcgcactggacgatcaacctcaaggatgcc
gacatccgcgaattcatcgaccagatttccgaaatcaccggcgagaccttcgtcgtcgac
ccgcgggtcaagggccaggtcagcgtggtctccaaggcccagctctcgttgagcgaggtc
taccagttgttcctctcggtgatgagcacccacggcttcaccgtggttgcccagggcgac
caggcgcgcatcgtgcccaacgccgaggccaagaccgaggccggcggcggccagagcgcg
ccggatcgcctggagacgcgggtgatccaggtgcagcagagcccggtatcggaactcatc
ccgctgatccgtccgctggtcccacaatatggccacctcgccgcggtgccctcggccaac
gcgctgatcatcagcgaccgcagcgccaatatcgcgcgaatcgaagacgtgatccgccag
ctcgaccagaagggcagccacgactacagcgtgatcaacctgcgctacggctgggtgatg
gacgccgccgaggtgctcaacaacgccatgagccgcggccaggccaagggcgcggcgggc
gcccaggtgatcgccgacgcgcgcaccaaccgcctgatcatcctcggcccgccgcaggcg
cgcgccaagctggtgcaactggcgcagtcgctggacaccccgaccgcgcgctcggccaat
acccgggtgatccgcctgcgccacaacgacgccaagaccctcgcggaaaccctcggccag
atttccgaaggcatgaagaacaacggcggccagggcggcgaacagaccggcggcggccga
ccgagcaacatcctgatccgtgccgacgaaagcaccaacgccctggtcctgctggccgac
ccggacacggtcaacgccctcgaggacatcgttcgccagctcgacgtgccgcgtgcccag
gtattggtggaggcggccatcgtcgagatctccggcgacatccaggatgccgtcggcgtg
caatgggcgatcaacaagggcggcatgggcggaaccaagaccaacttcgccaataccgga
ctgtccatcggcaccctgctgcaatcgctcgagagcaacaaggcaccggaatccatcccc
gacggcgccatcgtcggcatcggcagcagcagcttcggcgcgctggtcaccgcgctctcg
gccaacaccaagagcaacctgctgtcgaccccgagcctgttgaccctggacaaccagaaa
gcggagattctggtcggccagaacgtaccgttccagaccggctcctacaccaccaacagc
gaaggttcgagcaacccgttcaccaccgtggagcgcaaggatatcggcgtcagcctcaag
gtcactccgcacatcaacgacggcgcggccctgcgcctggagatcgagcaggagatctcg
gccctgctgcccaacgcccagcagcgcaacaataccgacctgatcaccagcaagcgctcg
atcaagagcaccatcctcgccgagaacggccaggtgatcgtgatcggcggcctgatccag
gacgacgtttcccaagccgagtcgaaggttcccctgctcggggacatcccattcctcggt
cgcctgttccgttccaccaaggacacccacaccaagcgcaacctgatggtcttcctgcgt
cctacggtggtccgcgacagcgccggtctcgccgcgctctcgggcaagaaatacagcgac
atccgggtcatcgacggcactcgcggcccggagggacgacccagcatcctgccgaccaac
gccaaccagttgttcgatggacaggccgtcgatctgcgcgaactgaagacggaataa

KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_40320Help
Entry
PA14_40320        CDS       T00401                                 

Gene name
xqhA
Definition
(GenBank) secretion protein XqhA
  KO
K02453  general secretion pathway protein D
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_40320 (xqhA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_40320 (xqhA)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_40320 (xqhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin Secretin_N
Motif
Other DBs
NCBI-ProteinID: ABJ11058
UniProt: A0A0H2Z9W0
Position
complement(3601871..3604201)
Genome map
AA seq 776 aa AA seqDB search
MPRCSTRSAQRLSPLFLVLSLAVLGLAPPVHPAPAATAAAQEEEQWTINMKDAEIGDFIE
QVSSISGQTFVVDPRVKGRVTVVSQARLSLAEVYQLFLSVLATHGYAVLPQGDQARIVPN
MEARQDAAQKTVRDGPGSLETRVVQAQQTSVAELIPMIRPLVPAHGHLAAVPSANALIVS
DRRANIERIEAIVRSLDRAGEHDYSIYDMRHAWVAEIAEVLDRSVTPAAGKSAATVQVLA
DSRSNRLVLLGPPQARARLLRLAQSLDVPSSRSANSRVIRLRHGDAKTLAATLGEIGESL
RGERGQDGRGSGKRGLLVRADESLNALVILADPEDVGLLEDIVRQLDVPRAQLLVEAAIV
ELSGEIGDALGVQWALRSGHVAGGAGFADSGLSIGTLLGALQAGKPPAELPDGAIVGLGS
RDFGALVTALSRNSRSNLLSTPSLLTLDNQKAEILVGQNVPFQTGSYTTSASGSSNPFTT
VERKDIGVTLKVTPHIGEDRMLRLEIEQEISSIAPTATLAAKAVDLVTNKRSIKSTVLAD
DGQVIVLGGLIQDDLLRSDSRVPLLGDIPGVGRLFRSSRETRVKRNLMVFLRPSIVRDAA
GLERISHGRYRSIQLLRGAAGEPVRPLFEDAGAIDLRPAAQVAPAPIGSPRSYPAPAPVL
MEKPRLADPASLGDGRGGEVLEVRQGTHAPQPPSPQRYAVRLVEGSSEAFMRALIERHPG
LSLRLRRELRDGQELFAVERGDYLDPEQARRALAELPESLPRGKARVIAHTPGSAL
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttgtagtacccgttccgcccagcgcctgtctccgctgttcctggtcctgtcg
ctggccgtcctcggcctggcgccgccggtccatccggcacctgccgcgactgccgccgcg
caagaggaagagcagtggacgatcaacatgaaggatgccgagatcggcgacttcatcgag
caggtatcgagcatcagcggccagaccttcgtcgtcgatccgcgggtgaagggacgggtc
acggtggtatcccaggcgcggctcagcctggcggaggtctaccaactgttcctttcggtg
ctcgccacccatggctacgcggtgctgccgcagggcgaccaggcgcgtatcgtgccgaac
atggaggcacgccaggacgccgcgcagaagaccgtccgcgatgggccgggcagcctggag
acgcgggtggtccaggcgcagcagacctcggtggcggaactgatcccgatgatccggccg
ctggtcccggcccatggccatctggccgccgtgccgtcggccaacgcgctgatcgtcagc
gaccgccgcgccaacatcgagcgcatcgaggcgatcgtgcgcagcctcgaccgggccggc
gaacatgactacagcatctacgacatgcgccatgcctgggtcgcggaaatcgccgaggtg
ctcgatcgcagcgtcaccccggccgccgggaagagcgccgccaccgtccaggtcctcgcc
gacagccgcagcaaccgcctggtcctgctcgggccgccgcaggcgcgagcgcgcttgctg
cggctggcgcagtcgctcgacgtcccctcgtcgcggtcggcgaacagccgggtgatccgc
ctgcgccatggcgacgccaagaccctcgccgccaccctcggggagatcggcgaatcgctg
cgcggcgagcggggccaggatggacggggaagcggcaagcgcggcctgctggtgcgcgcc
gacgaatcgctgaatgccctggtgatcctcgccgacccggaggatgtcggtctgctcgag
gacatcgtccgccagctcgacgtgccgcgtgcgcaactgttggtggaggcggcgatcgtc
gagctgtccggcgagatcggcgacgccctcggggtgcaatgggcgctgcgtagcgggcat
gtcgccggcggcgctggcttcgccgacagcgggttgtccatcggcaccctgctaggcgcg
ttgcaggccggcaagccgccggcagagctgcccgacggtgcgatagtcggcctcggcagt
cgcgatttcggcgcactggtcaccgcgctgagccgcaatagccgcagcaacctgctgtcg
acgccgagcctgctgaccctggacaaccagaaggcggaaatcctggtcggccagaacgtg
ccgttccagaccggcagctacaccaccagcgccagcggttcgagcaatccgttcaccact
gtcgagcgcaaggatatcggggtgaccctcaaggtcacgccgcacatcggcgaggaccgc
atgctgcgcctggagatcgagcaggaaatatcctccatcgcgccaaccgccaccttggcg
gcgaaggcggtggacctggtgaccaacaagcgctcgatcaagagcaccgtactggccgac
gacggccaggtcatcgtcctcggcggactgatccaggacgacctgctgcgcagcgattcg
cgggtaccgctgctgggcgacatccccggcgtcggccggctgttccgctcgtcccgcgag
acccgggtgaagcgcaacctgatggtcttcctgcgaccgagcatcgtccgcgatgccgcc
ggcctggagcgcatcagccatggccgttaccgttccatccagttgctgcgcggtgccgcc
ggcgaaccggtacgcccgctgttcgaggatgccggcgccatcgacctgcgtcccgccgcc
caggtcgcaccggcacctattggctcgccgcgcagctatccggctccagccccggtgctg
atggagaagccgcgcctggcggacccggcgtccctgggcgacggtcgcggcggcgaggtg
ctggaggttcgccagggcacgcacgcgccgcagccgccgtcaccccagcgctacgccgtg
cgattggtcgagggcagcagcgaagccttcatgcgcgcgctgatcgagcggcatccgggc
ctgtcgttgcgtttgcgccgcgaactgcgcgatggccaggagctgttcgcggtggagcgg
ggcgactacctcgacccggagcaggcacgccgggccctggcggaactgcccgaaagcctg
ccgcgagggaaggcgcgggtgattgcgcatacgccgggaagcgccctgtga

KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_55450Help
Entry
PA14_55450        CDS       T00401                                 

Gene name
hxcQ
Definition
(GenBank) probable type II secretion system protein
  KO
K02453  general secretion pathway protein D
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_55450 (hxcQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_55450 (hxcQ)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_55450 (hxcQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretin Secretin_N
Motif
Other DBs
NCBI-ProteinID: ABJ09828
UniProt: A0A0H2Z6Q2
Position
complement(4934944..4937355)
Genome map
AA seq 803 aa AA seqDB search
MRQSAFHHARRRWPVLGVALGALLVAACSETPKVPGVPPADEEVGRPLSSVRSGAPLRSA
DVRERPQAEQARRALSAGRGVARSGAVAPVSAAAAELGEQPVSLNFVDTEVEAVVRALSR
ATGRQFLVDPRVKGKLTLVSEGQVPARTAYRMLTSALRMQGFSVVDVDGVSQVVPEADAK
LLGGPVYGADRPAANGMVTRTFRLRYENAVNLIPVLRPIVAQNNPINAYPGNNTVVVTDY
AENLDRVAGIIASIDIPSASDTDVVPIQNGIAVDIASTVSELLDSQGSGGAEQGQKTVVL
ADPRSNSIVIRSPSPERTQLARDLIGKLDSVQSNPGNLHVVYLRNAQATRLAQALRGLIT
GDSGGEGNEGDQQRARLSGGGMLGGGNSGTGSQALGSSGNTTGSGSSGLGGSNRSGGAYG
AMGSGQGGAGPGAMGEENSAFSAGGVTVQADATTNTLLISAPEPLYRNLREVIDLLDQRR
AQVVIESLIVEVSEDDSSEFGIQWQAGNLGGNGVFGGVNFGQSALNTAGKNTIDVLPKGL
NIGLVDGTVDIPGIGKILDLKVLARALKSRGGTNVLSTPNLLTLDNESASIMVGQTIPFV
SGQYVTDGGGTSNNPFQTIQREDVGLKLNIRPQISEGGTVKLDVYQEVSSVDERASTAAG
VVTNKRAIDTSILLDDGQIMVLGGLLQDNVQDNTDGVPGLSSLPGVGSLFRYQKRSRTKT
NLMVFLRPYIVRDAAAGRSITLNRYDFIRRAQQRVQPRHDWSVGDMQAPVLPPAQQGIPQ
AAYDLRPSPRPLRAVPLGEAAPL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaatcagctttccaccatgcccggcgtcgttggcctgtactgggcgtggcgctg
ggcgcgctactggtcgcggcgtgtagcgagacgccgaaggtccccggcgtgcccccggcc
gacgaggaagtcggtcggccgctgagcagtgtccgctccggtgcgccgttgcgcagcgcc
gacgtccgcgagcggccccaggccgagcaggcccgccgcgcgctgagtgccgggcgcggc
gtagcgcgctccggtgccgtggctccggtctcagcggcagcggccgaactcggcgagcag
ccggtcagcctgaatttcgtcgataccgaggtggaagcggtggtgcgcgcgctgtcgcgc
gccaccggccggcagttcctggtcgacccgcgggtgaagggcaagctgaccctggtttcc
gaaggccaggtgccggcgcgcaccgcctaccgcatgctcaccagcgccctgcgcatgcag
ggcttcagcgtggtcgacgtcgacggggtcagccaggtggtgccggaggccgacgccaag
ctgctcggcgggccggtctacggcgccgaccggccggcggccaacggcatggtcacgcgg
accttccgcctgcgttacgagaacgcggtgaacctgatcccggtgctgcgcccgatcgtc
gcgcagaacaacccgatcaatgcctatccggggaacaacaccgtggtggtcaccgactac
gcggaaaacctcgatcgggtcgccgggatcatcgccagcatcgacatccccagcgccagc
gacaccgacgtggtgccgatccagaacggtatcgcggtggacatcgccagcaccgtctcc
gaactgctcgacagccagggcagcggcggcgccgagcagggccagaagaccgtggtgctc
gccgacccacgctccaacagcatcgtgatccgctcgccgagcccggagcgcacgcaattg
gcgcgcgacctgatcggcaagctggacagcgtgcaaagcaatcccggcaacctccatgtg
gtctacttgcgcaacgcccaggcgacccgcctggcccaggccctgcgcgggctgatcacc
ggcgacagcggcggcgagggcaacgagggcgaccagcagcgcgcgcgcctgagcggcggc
ggcatgctcggtggcggcaacagcggtactggtagccaggccctggggagcagcggcaat
accacgggcagcggttccagcgggttgggcggcagcaaccgcagcggcggcgcctatggt
gcgatgggcagcggccagggcggcgccggacccggtgcgatgggcgaggagaactcggcg
ttctccgccggcggggtcaccgtacaggccgacgccaccaccaacaccctgctgatttcc
gcacccgagccgttgtaccgcaacctccgcgaagtcatcgacctgctcgaccagcgccgc
gcccaggtggtgatcgaaagcctgatcgtcgaggtcagcgaagacgactccagcgagttc
ggcatccagtggcaggccggcaacctcggcggcaacggcgtgttcggcggggtcaacttc
ggccagtcggcgctgaacacggccggcaagaacaccatcgacgtgttgcccaaggggctc
aacatcggcctggtggatggcaccgtggacatccccgggatcggcaagatcctcgacctc
aaggtgctcgcccgggcgctgaagagccgcggcggcaccaacgtcctgtcgaccccgaac
ctgctgaccctggacaacgagtcggcgagcatcatggtcggccagaccatacccttcgtc
agcggccagtacgtcaccgacggcggcggtaccagcaacaacccgttccagaccatccag
cgcgaggacgtcggcctgaagctgaacatccgtccgcagatctccgagggcggcacggtc
aagctcgacgtctaccaggaggtcagcagcgtcgacgagcgcgccagcaccgccgccggg
gtggtcaccaacaagcgcgcgatcgataccagcatcctcctcgacgacggccagatcatg
gtcctcggcggcctgttgcaggacaacgtgcaggacaacaccgacggcgttcccggactc
tccagcctccccggcgtcggctcgctgttccgctaccagaagcgctcgcggaccaagacc
aacctgatggtcttcctgcgtccctacatcgtccgcgacgccgccgccgggcgcagcatc
accctcaaccgctacgacttcatccgccgcgcccagcagcgcgtgcagccgcgccacgac
tggagcgtcggcgacatgcaggctccggtgctgccgccggcgcagcagggcatcccgcag
gccgcctacgacttacgcccgagcccgcggccgctgcgcgcggtaccgctgggcgaggcg
gcgccgctatga

DBGET integrated database retrieval system