KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_24010Help
Entry
PA14_24010        CDS       T00401                                 

Gene name
xcpS
Definition
(GenBank) general secretion pathway protein F
  KO
K02455  general secretion pathway protein F
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_24010 (xcpS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_24010 (xcpS)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_24010 (xcpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF
Motif
Other DBs
NCBI-ProteinID: ABJ12334
UniProt: A0A0H2ZDF1
Position
2086376..2087593
Genome map
AA seq 405 aa AA seqDB search
MAAFEYLALDPSGRQQKGVLEADSARQVRQLLRERQLAPLDVKPTRTREQSGQGGRLTFA
RGLSARDLALVTRQLATLVQAALPIEEALRAAAAQSTSQRIQSMLLAVRAKVLEGHSLAG
SLREFPTAFPELYRATVAAGEHAGHLGPVLEQLADYTEQRQQSRQKIQLALLYPVILMVA
SLAIVGFLLGYVVPDVVRVFIDSGQTLPLLTRVLIGVSDWVKAWGALAFVAAIGGVIGFR
YALRKDAFRERWHGFLLRVPLVGRLVRSTDTARFASTLAILTRSGVPLVEALAIAAEVIA
NRIIRNEVVKAAQKVREGASLTRSLEATGQFPPMMLHMIASGERSGELDQMLARTARNQE
NDLAAQIGLMVGLFEPFMLIFMGAVVLVIVLAILLPILSLNQLVG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttcgaatacctcgccctcgaccccagcggtcgccagcagaagggcgtgctg
gaggcggacagcgcgcgccaggtccgccaattgctgcgcgagcgccaattggcgccgctc
gatgtgaagcccacccgtacccgcgagcagagcgggcagggcgggcgcctgacgttcgcc
cgcggactgtccgcgcgcgacctggcattggtgacccggcaactggcgaccctggtccag
gccgcgttgccgatcgaggaggcgctgcgcgccgccgcggcgcagtccacctcgcagcgc
atccagtcgatgcttctcgccgtgcgcgccaaggtcctcgagggccatagcctggccggc
agcctgcgcgagtttcccaccgcctttcccgagctgtaccgggcgactgtggctgccggc
gagcatgccgggcacctcggcccggtgctggagcaacttgccgactacaccgagcagcgc
cagcagtcgcggcagaagatccagctggcgctgctctatccggtgatcctgatggtcgct
tcgctggccatcgtcggcttcctgctgggctacgtggtgcccgacgtggtccgggtgttc
atcgacagcgggcagacgctgccgctgttgacccgcgtgctgatcggcgttagcgactgg
gtcaaggcctggggcgcgctggccttcgtcgcggcgatcggcggggtgatcggcttccgc
tacgcgctacgcaaggatgcctttcgcgagcgctggcatggcttcctgctgcgcgtgccg
ctggtcggtcggctggtgcgttccaccgacaccgcgcgcttcgcctcgaccctggcgatc
ctcacccgcagcggcgtgccgctggtggaggcgctggcgatcgccgccgaggtgatcgcc
aaccggatcatccgcaacgaagtggtcaaggccgcgcagaaggtccgcgagggcgccagc
ctgacccgctcgctggaagccaccggacagttcccgccgatgatgctgcacatgatcgcc
agcggcgagcgctccggcgagctggaccagatgctggcgcgcaccgcgcgcaaccaggag
aacgacctggcggcgcagatcggcctgatggtcggcctgttcgaaccgttcatgctgata
ttcatgggcgcggtggtgctggtcatcgtccttgccattcttcttccgatcctttctctc
aaccaactcgtggggtaa

KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_29500Help
Entry
PA14_29500        CDS       T00401                                 

Gene name
hplS
Definition
(GenBank) putative type II secretion system protein
  KO
K02455  general secretion pathway protein F
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_29500 (hplS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_29500 (hplS)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_29500 (hplS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF
Motif
Other DBs
NCBI-ProteinID: ABJ11898
UniProt: A0A0H2ZB16
Position
2558922..2560109
Genome map
AA seq 395 aa AA seqDB search
MNFIYQAVDRKGRRVRGELCLPTRQDALRQLQRQGLTPLSLEVKRRNLGSRRRLKAEELN
MAIHELATMLAAGVSMADAVEAQERGARHPKLISALQAMANGLRQGQSFPVVLESAGLDL
PRYVYQLVAAGEMTGNLAGALRDCATQMEYERRTRAELQGALIYPAILVLSGVLAVATLF
VFVVPKFANLLNETAQLPWLAWAVLSIGVWSNESSGLLAFAVLLLAGGIAVALRNPALRA
HALDQLVRLPVVGEWLMQAEIAQWSKVLGTLLGNRVPLVEALALSAAGVRIARQRRTLER
VTQDVRAGIALSAALEERQAVTSIGSSLVRVGEASGQLAEMLQSLATLYGEAGQARMKKA
LVLIEPLAILLIGSVFGLIITGVVLAITSANDMVL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcatctaccaagccgtcgatcgcaagggcaggcgcgttcgtggcgaactctgc
ctccccacgcgccaggatgcgctgcggcagttgcagcgccaggggctcaccccgctcagc
ctggaggtgaaacgccgcaacctgggctcgcgacgtcggctcaaggccgaggaattgaac
atggccatccacgagctggccaccatgctcgcggcgggagtgagcatggccgacgcggtg
gaggcccaggagcgaggcgcgcgccacccgaagttgatttccgccctgcaggcgatggcc
aatggtctgcgccaggggcagtcctttcccgtggtgctggagagcgccggcctcgacctg
ccgcgctatgtatatcaactggtggcggccggcgagatgaccggaaacctcgcaggagcc
ctgagggactgtgccacgcagatggaatacgaacggcgaacccgcgccgagttgcaaggg
gcgctgatctaccctgcgattctggtgctcagcggggtgctcgccgtggcgaccctgttc
gtcttcgtcgttccgaaattcgccaatctcctgaacgagaccgcccagcttccgtggctt
gcctgggcagtgctgagcatcggggtatggagcaacgagagttccggcttgctggcgttc
gccgtcctgctgcttgctggcggcattgccgtggcgctgcgcaatccggcgctccgcgcc
catgcgctcgaccagttggtgcgcctgcccgtagtcggggaatggttgatgcaggcggaa
atagcgcaatggtcgaaggtgcttggaaccctgctgggaaatcgtgtgccgctggtggag
gccctggcgctttccgccgctggcgtccgcattgcccggcagcgccggaccctggagcga
gtcacccaggatgtgcgggccggcatcgccttgtcggcagcgttggaggagcgccaggcg
gtcacgtccatcggttcgagcctggtgcgggttggagaggcctccgggcagctcgcggag
atgctgcagagcctggcgacgctctatggagaggccgggcaggcgcgaatgaaaaaggcc
ctggtgctgatcgagcctctggcgatcctgctgatcggctctgtgttcggcctgatcatt
accggcgtggtactggcgattaccagcgccaacgacatggtgctttga

KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_55430Help
Entry
PA14_55430        CDS       T00401                                 

Gene name
hxcS
Definition
(GenBank) probable type II secretion system protein
  KO
K02455  general secretion pathway protein F
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_55430 (hxcS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_55430 (hxcS)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_55430 (hxcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF Prok-E2_C DUF2062 DUF1056
Motif
Other DBs
NCBI-ProteinID: ABJ09830
UniProt: A0A0H2Z6F5
Position
complement(4932324..4933538)
Genome map
AA seq 404 aa AA seqDB search
MQTFRYEAADAQGRIETGTLEADSQRGALGQLRARGLTPLEVREQAGGGTGQGAGALFAP
RLSDGDLAWATRQLASLLAASLPLEAALSATLDQAERKHIAQTLSAVRSDVRGGMRLADA
LAARPRDFPEIYRALVAAGEESGDLAQVMERLADYIEERNALRGKILTAFIYPAVVGVVS
IGIVIFLLGYVVPQVVSAFSQARQDLPALTRAMLQASDFVRAWGWLCAGAIGGAYWGWRL
YLRDPQARLGWHRRVLRLPLLGRFVLGVNTARFASTLAILGSAGVPLLRALDAARQTLAN
DCLAQAVEEATAQVREGVSLASALRTRQVFPPILTHLIASGEKTGALPPMLDRAAQTLSR
DIERRAMGMTALLEPLMIVVMGGVVLTIVMAVLMPIIEMNQLVQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccttccgctacgaagccgccgacgcccagggccggatcgagaccggcaccctg
gaggcggacagccagcgtggcgcccttggccaactgcgcgcccgcggcctgaccccgctg
gaggtccgcgaacaggctggcggcgggaccgggcaaggggcgggagcgctgttcgccccg
cgcctgtccgacggcgacctggcctgggccacccgccaactggccagcctgctggccgcc
agcctgccgctggaggcggcgctgagcgccaccctcgaccaggccgagcgcaagcacatc
gcccagaccctgagcgccgtgcgcagcgacgtgcgcggcggcatgcgcctggccgacgcc
cttgccgcacggccgcgggacttcccggaaatctaccgggcgctggtggctgcgggcgag
gagtccggcgacctggcccaggtgatggagcgcctggccgactacatcgaggaacgcaac
gccctgcgcggcaagatcctcaccgcgttcatctacccggcggtggtcggcgtggtctcc
atcggcatcgtcatcttcctcctcggctacgtggtgccgcaggtggtcagcgccttctcc
caggcgcgccaggacctgccagcgctgacccgggcgatgctccaggccagcgacttcgtg
cgcgcctggggctggctctgcgccggcgccatcggtggcgcttactggggctggcgcttg
tacctgcgcgacccgcaggcgcggctcggctggcaccggcgagtgctgcgcctgcctctg
ctcggacgcttcgtgctcggggtgaataccgcgcgcttcgcctccaccctggcgatcctc
ggcagcgccggcgtaccgctgctgcgcgcgctcgatgcggcgcgccagacgctggccaac
gactgcctcgcgcaggcggtggaggaggccaccgcgcaggttcgcgaaggtgtctcgctg
gcctcggcgctgcgcacgcggcaggtattcccgccgatcctcacccacctgatcgccagc
ggcgagaagaccggcgcgctgccgccgatgctcgaccgcgcggcgcagaccctgtcgcgc
gacatcgagcgccgcgccatgggcatgaccgcgctgctcgagccgctgatgatcgtggtc
atgggcggggtggtgctgaccatcgtgatggcggtgctgatgccgatcatcgagatgaac
cagctggtccagtag

DBGET integrated database retrieval system