KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_24080Help
Entry
PA14_24080        CDS       T00401                                 

Gene name
xcpY
Definition
(GenBank) general secretion pathway protein L
  KO
K02461  general secretion pathway protein L
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_24080 (xcpY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_24080 (xcpY)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_24080 (xcpY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSL GspL_C
Motif
Other DBs
NCBI-ProteinID: ABJ12328
UniProt: A0A0H2ZDC9
Structure
PDB: 

Position
2090660..2091808
Genome map
AA seq 382 aa AA seqDB search
MSGVSALFLPPASTAGADGELAVWWVQDGECRRAPFVQALAEIRAPWRLYLPVEAVTACA
VNLPTQKARWLRQSLPFAVEEQLADDVEQMHLALGPALADGRHRVFAVQRTWLAAWLALA
EGAGKAPASLHVDADCLPGEGSCLFWLEERWLLGGSGAVRLACGSEDWPVLRDSCPPPQR
AFAAQEVAPLEGVEVQALAGNPHVWLSEQPLGTDLAQAEFAARQQSSQWRRWRPLLGLVG
LWLVLQWGFTLVQAWQLQREGDRYAAQSAELYRQLFPEDRKLINLRAQFDQHLADSASSG
GEGQLLGLLGQAATVIGGEPTVSVEQLDFSAARGDVALQVRAPGFDVLERLRSRLSESGL
AVQLGSASRDGSTVSARLVIGG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtgagtgcgctgttcctgccgcccgccagcacggcgggggccgatggggaa
ctggcggtatggtgggtgcaggatggcgagtgccggcgcgcgccgttcgtccaggcgctg
gcggagatccgcgcgccctggcggctgtacctgccggtggaggcggtgaccgcctgcgcg
gtgaacctgcctacgcagaaggcgcgctggttgcgccagtcgctgccgtttgcggtggag
gaacaactggccgacgatgtcgagcagatgcaccttgcccttggtccggcgctggccgac
ggccgccaccgggtattcgccgtgcagcgcacctggctcgccgcctggctggcgctggcc
gagggcgcgggcaaggcgccggcttcgctgcatgtcgatgccgattgcctgccgggcgag
ggcagttgcctgttctggctggaagagcgctggttgctcggcggcagcggcgccgtacgc
ctggcctgcggcagcgaggattggccggtactgcgcgacagttgcccgccgccgcagcgg
gccttcgccgcgcaggaggtggcgcccctggagggggtggaagtccaggccctggcgggc
aatccgcacgtctggctgagcgagcagccgctgggcaccgacctggcccaggccgagttc
gccgcgcgccagcagagtagccagtggcgccgttggcggccgctgctggggctggtcggg
ctgtggctggtgttgcaatggggctttaccctggtccaggcctggcagttgcagcgcgaa
ggcgaccgctacgcggcgcagagcgcagagctctaccgccagttgtttcccgaggaccgc
aagctgatcaacctgcgcgcgcagttcgaccagcacctggccgacagcgccagcagcggc
ggcgagggccagttgctcggcctgcttggccaggccgccacggtgatcggcggcgagcca
acggtgagcgtcgagcaactggacttcagcgccgctcgcggcgacgtcgccctccaggtg
cgggctcccggtttcgacgtgctggaacggctgcgttcgcgtctcagcgagtccgggttg
gcggtgcagctgggttcggccagccgcgatggctcgacggtcagcgcgcgcctggtgata
ggaggttga

KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_55470Help
Entry
PA14_55470        CDS       T00401                                 

Gene name
hxcY
Definition
(GenBank) probable type II secretion system protein
  KO
K02461  general secretion pathway protein L
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_55470 (hxcY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_55470 (hxcY)
Secretion system [BR:pau02044]
 Type II secretion system
  General secretion pathway protein
   PA14_55470 (hxcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GspL_C T2SSL DUF3563
Motif
Other DBs
NCBI-ProteinID: ABJ09826
UniProt: A0A0H2Z738
Position
complement(4937932..4939074)
Genome map
AA seq 380 aa AA seqDB search
MRLDARGAVQERIEASLAELARRRQGLPVALFLHPRDCRLVSLELPALPAAKLAAAVNCA
AEALVLGDPAQLRLAHGPRGADGRLTLGWLEASALASLEQAVQRLRLDVREVQAAPFLLP
LRDDAWVAGEWDGHLLLRRSLSDAAVHPLPEQGLAEVPQELRLFWLGERPAWGSAALERA
EALDEALRWSGPASPWGLALKAPATSAGNGTWKMPLVCAALALLVWVAGLNLYAGQLAGQ
GQSLQRQSSQRVQQAFPELPVVLDPLRQARERRDAYLAGKADGDAVPGLAALLHGAGEAM
PFLAGRLQRLDYHAGELDLELLPGPPGGDAAAWQGELGKHGLQADASDKGWQVRAMEAPP
APAAGAAGSGTAEAAADEDE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ctgcgcctggatgcgcgcggcgcggtgcaggaacgaatcgaggcctcgctcgcggaactg
gcgcggcgacgccaggggttgccggtggcgctgttcctgcatccgcgcgattgccgcctg
gtcagtctcgaactgccggcgctgcctgcggcgaagctcgccgccgcggtgaactgcgcg
gccgaggcgctggtcctcggcgatccggcgcagctacgcctggcccacggcccgcgcggc
gccgacgggcgcctgaccttggggtggctggaggcgtcggcgctggcctcgctggagcag
gccgtgcagcggctgcggctcgacgtgcgggaggtgcaggccgcgccgttcctcctgccg
ttgcgcgatgacgcttgggtggccggcgagtgggacggccatctgctgttgcgccgctcg
ctgagcgacgctgcggtccatcccttgccggagcagggcctcgctgaggtcccgcaggag
ttgcgactgttctggctgggcgagcgaccggcgtggggctccgcagccctggagcgggcc
gaggcgctggacgaagcgctgcgctggagcgggcccgccagtccgtggggattggcgctg
aaagcgccggcgacgagcgccggcaacggcacctggaagatgcccctggtctgcgcagcc
ctggccttgctggtgtgggtcgccggcctgaacctgtacgccgggcaactggccgggcag
ggccagtccttgcaacggcagagcagtcaacgcgtgcagcaggccttcccggaactgccg
gtggtgctcgatccgttgcgccaggctcgcgagcgacgcgacgcctatctggccggcaag
gccgatggcgatgccgtaccggggctggccgcgctgctgcatggcgccggcgaggcgatg
ccgttcctcgccggacgcctgcaacgactggactaccacgccggcgaactggacctggag
ctgctgccgggaccgccaggcggcgatgccgctgcctggcagggcgagttgggcaagcac
gggttgcaggccgatgcctccgacaagggctggcaggtgcgcgccatggaagcgccgcca
gcgccggccgctggcgcggcaggcagtggcactgccgaggcggctgccgatgaagatgaa
taa

DBGET integrated database retrieval system