KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30190Help
Entry
PA14_30190        CDS       T00401                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00020  Citrate cycle (TCA cycle)
pau00480  Glutathione metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
pau01210  2-Oxocarboxylic acid metabolism
pau01230  Biosynthesis of amino acids
Module
pau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA14_30190 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PA14_30190 (icd)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PA14_30190 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ABJ11846
UniProt: Q02NB5
Structure
PDB: 

Position
2615108..2616364
Genome map
AA seq 418 aa AA seqDB search
MGYQKIQVPATGDKITVNADMSLSVPKNPIIPFIEGDGIGVDISPVMIKVVDAAVEKAYK
GERKIAWMEVYAGEKATQVYDQDTWLPQETLDAVRDYVVSIKGPLTTPVGGGIRSLNVAL
RQQLDLYVCQRPVRWFEGVPSPVKKPGDVDMVIFRENSEDIYAGVEWKAGSPEAEKVIKF
LTEEMGVKKIRFTENCGIGIKPVSQEGTKRLVRKALQYAVDNDRSSVTLVHKGNIMKFTE
GAFKDWGYEVARDEFGAELLDGGPWMQFKNPKTGKNVVVKDVIADAMLQQILLRPAEYDV
IATLNLNGDYLSDALAAEVGGIGIAPGANLSDSVAMFEATHGTAPKYAGQDKVNPGSLIL
SAEMMLRHMGWTEAADLIIKGTNGAIAAKTVTYDFERLMDGATLLSCSEFGDAMIAKM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggataccaaaagatccaggtgccggcgaccggtgacaaaatcactgtgaatgccgac
atgtccttgagcgtaccgaagaacccgatcatcccgttcatcgagggtgatggcatcggc
gtcgatatcagcccggtcatgatcaaggttgtcgacgctgcagtggaaaaagcatacaag
ggcgagcgcaagatcgcctggatggaagtctacgccggcgagaaggccacccaggtgtat
gaccaggacacctggctgccccaggaaaccctggacgccgtgcgcgactacgtggtttcc
atcaagggtccgctgaccaccccggtcggtggcggcatccgttccctgaacgtggccctg
cgccagcaactcgatctctacgtctgccagcgcccggtacgctggttcgaaggcgtgccc
agcccggtgaagaagcccggcgacgtagacatggtgatcttccgcgagaactccgaggac
atctatgccggcgtcgagtggaaggccggttcgccggaggcggagaaggtcatcaagttc
ctcaccgaggaaatgggcgtcaagaaaatccgcttcaccgagaactgcggcatcggcatc
aagccggtttcccaggaaggcaccaagcgcctggtgcgcaaggccctgcaatacgccgtc
gacaacgaccgcagttcggtgaccctggtgcacaagggcaacatcatgaagttcaccgag
ggtgccttcaaggattggggttacgaagtcgcgcgcgatgaattcggcgccgagctgctg
gacggcggtccgtggatgcagttcaagaacccgaagaccggcaagaacgtcgtggtcaag
gacgtgatcgccgacgccatgttgcagcagattctgctgcgccccgccgagtacgacgtg
atcgccaccctgaacctgaacggcgactatctctccgacgccctggcggccgaggtcggc
ggcatcggcatcgcgcccggcgccaacctgtccgattcggtggccatgttcgaggcgacc
cacggcaccgcgccgaagtacgccggccaggacaaggtcaacccgggttcgctgatcctc
tccgcggagatgatgctgcgccacatgggctggaccgaggcggccgacctgatcatcaag
ggcaccaacggggcgatcgccgccaagaccgtgacctatgacttcgaacgcctgatggac
ggcgcgaccctgctgtcctgctcggagttcggcgacgcgatgatcgccaagatgtag

DBGET integrated database retrieval system