KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30340Help
Entry
PA14_30340        CDS       T00401                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00860  Porphyrin and chlorophyll metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
Module
pau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA14_30340 (cysG)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     PA14_30340 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PA14_30340 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     PA14_30340 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABJ11834
UniProt: Q02NA3
Position
2628497..2629894
Genome map
AA seq 465 aa AA seqDB search
MDFLPLFHSLQGRLALVVGGGEVALRKARLLADAGARLRVVAPQIHIELRHLVEQGGGEL
LERDYQDGDQPGCALIIAATDDEPLNAEVSRAANARGIPVNVVDAPALCSVIFPAIVDRS
PLVVAVSSGGDAPVLARLIRAKLETWIPSTYGQLAGLASRFRHRVKELLPDLQQRRVFWE
NLFQGEIAERVLAGRPAEAERLLEERLAGGLAHIATGEVYLVGAGPGDPDLLTFRALRLM
QQADVVLYDRLVAPSILELCRRDAERLYVGKRRAEHAVPQDRINRLLVELASQGKRVLRL
KGGDPFIFGRGGEEIDELAARGIPFQVVPGITAASGCAAYAGIPLTHRDHAQSVRFVTGH
LKDGTTDLPWQDLVAPGQTLVFYMGLVGLPVICEQLVAHGRSAQTPAALIQQGTTAQQRV
FTGTLENLPQLVAEHEVHAPTLVIVGEVVQLRDKLAWFEGAREDA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatttcctgccgctgttccactccttgcaagggcgcctcgcgctggtggtcggcggc
ggcgaagtcgccctgcgcaaggcgcgcctgctggccgacgccggcgcgcgcctgcgcgtg
gtcgcaccgcagatccacatcgaactgcggcatctggtggagcagggcggcggcgagctg
ctcgaacgcgactaccaggacggcgaccagcccggctgcgccctgatcatcgccgccacc
gacgacgaaccgctgaacgccgaggtgtcgcgagcggccaatgcgcgcgggataccggtc
aacgtggtggacgcgccggccctgtgcagcgtgatcttcccggccatcgtcgaccgttcg
ccgctggtggtggcggtctccagcggcggcgatgcgcccgtgctggcgcggctgatccgg
gccaagctggaaacctggattccctcgacctacgggcaactggccggactcgccagccgc
ttccgccaccgggtcaaggaattgctacccgacctgcagcagcgccgggtgttctgggaa
aacctgttccagggcgagatcgccgagcgtgtcctggccggccgtccggcggaagccgag
cgtctcctggaggagcgcctggccggcggcctcgcgcacatagccacgggcgaggtatat
ctggtcggggccgggccgggggatccggacctgctgacgttccgtgccctgcgcctgatg
cagcaggccgacgtggtgctctacgatcgcctggtggcgccgtcgatcctcgaattatgc
cgccgcgatgccgaacgcctgtacgtcggcaagcgccgcgccgaacatgcggtgccgcag
gatcggatcaaccgcctgctggtggagctggccagccagggcaagcgcgtgctgcgcctg
aagggtggcgacccgttcatcttcggccgcggcggtgaggaaatcgacgaactggctgcc
cgcggcatacctttccaggtcgtgccgggaatcaccgcggccagcggctgcgcggcctac
gccgggattccactgactcatcgcgatcatgcgcaatcggttcgtttcgtcaccggtcat
ctgaaggacggcaccaccgacctgccgtggcaggacctggtagcgcctggccagaccctg
gtgttctacatgggcctggtgggattgccggtgatctgcgagcaactggtcgcccacggt
cgctccgcacagaccccggcggcgctgatccagcaggggaccaccgcccagcagcgggta
ttcaccggaaccctggaaaacctgccgcaactggtggctgagcacgaagtgcatgcgccg
accctggtgatcgtcggcgaagtcgtgcaactgcgcgacaagctggcctggttcgaaggc
gcccgcgaggacgcctga

DBGET integrated database retrieval system