KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30860Help
Entry
PA14_30860        CDS       T00401                                 

Gene name
trbG
Definition
(GenBank) TrbG-like protein
  KO
K20532  type IV secretion system protein TrbG
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA14_30860 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_30860 (trbG)
Secretion system [BR:pau02044]
 Type IV secretion system
  Trb secretion system protein
   PA14_30860 (trbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ABJ11791
UniProt: A0A0H2ZC28
Position
complement(2679709..2680698)
Genome map
AA seq 329 aa AA seqDB search
MNDVFRKSALPLILLALAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVKVPEPLALP
AQLKPLPEAEAAKPVPEPADETVRVSRANAEARIAPTREGYVNAIQVWPYTDGALYQVYA
AVGRVTVITLQPGEELVTVAAGDTVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVIT
TSRRTYLLELTSTEKTWMASVSWEYPKDKMLALQRQAQAASAAAPVDTGLSLEKIRFRYA
ISGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGDGQLVNYRFRAPYYIVD
RLFGAAELRLGGDKGDVVRIERTDGARRN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgttttccgcaaatccgccttgccgctgatcctgctggccctcgcgggctgc
gccacgcagggcaagccgccgccgaccatctcgctcgatgagccggtgcaggcgcagccg
ctgccggagccgcccgcgccggtggaggtggtcaaggtgcccgagccgctggcgctgccg
gcgcagttgaagccattgcccgaagccgaggctgccaagcccgtccctgaacctgccgac
gaaaccgtgcgcgtctcgcgtgccaacgccgaggcccgcatcgcgcccacgcgcgagggc
tacgtcaatgcgattcaggtgtggccctacaccgatggcgcgctgtatcaggtctatgcg
gccgtgggccgcgtgaccgtgatcacgctccagccgggcgaggaactggtgacggtcgcc
gctggcgacactgtgcgctggatcgtgggcgacacatccagcggcagcggtgatgcgctg
cgcgtgaacgtgatggtgaagcccatccgctcgggcctcaagacgaatctggtcatcacc
accagccggcgcacctacctgctggagctgacctcgacagagaagacgtggatggcgtca
gtgtcgtgggagtacccgaaggacaagatgctggccttgcagcgccaggcgcaggcggcc
agcgccgccgcgccagtcgataccggcttgtcgctggagaagatccgcttccgctacgcg
atcagcggcagcaatccgccgtggaagccgctgcgcgccttcgatgacggcgagaaggtc
tatatccagttcccgccgggcatcgcgcaaggcgagctgccgccgctgttcgtcatcggc
gcgcagggcgacgggcaactggtgaactaccgcttccgtgcgccgtactacatcgtggat
cgcctctttggggcggcggagctgcgcttgggcggcgacaagggcgacgtggtgcggatc
gagcgcacggacggcgcgcggaggaactga

DBGET integrated database retrieval system