KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_30960Help
Entry
PA14_30960        CDS       T00401                                 

Gene name
traG
Definition
(GenBank) TraG-like protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_30960 (traG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_30960 (traG)
Enzymes [BR:pau01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     PA14_30960 (traG)
Secretion system [BR:pau02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PA14_30960 (traG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Motif
Other DBs
NCBI-ProteinID: ABJ11782
UniProt: A0A0H2ZC35
Position
complement(2688485..2690485)
Genome map
AA seq 666 aa AA seqDB search
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDFLGTPIYYPWKLFEW
WFSYGAYTPEIFDTGGAIAGGSGMVAVAVAIAMSVWRSRQARLVTTYGSARWANAQDIRK
AGLTQPVGVFLGQYDRQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKG
ENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
KRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPASPFELTLHRMMTTPHLGDGP
HPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLISAEHPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIERRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLG
TATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKA
RKLRYYADANFKRRVLPPPALADCQYADAPPLRADDWSGLAIPPTPTAPATASADGLGSA
DDGGPRRQPELSEAVAYDPELAAPAADLGLLDDDDDLPLPLPRQLDPAMQRTARLASLDP
NDGIEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcaagggacgaacgtgctgttcggtcagatcgccgtggtattcggcatcgtgatcgcc
ggagtgtggggcgccacacaatggacagcagcagcccttggctatcagctacgccttggc
tcgccctggttcgattttcttggcacgccgatctactacccgtggaagctgtttgagtgg
tggttctcttacggcgcctataccccggaaatcttcgacacgggcggagccatcgccggt
ggcagcggcatggtcgccgtggccgtcgccattgccatgtcggtctggcgctcgcgacag
gcacgcctggtcacgacctacggttcggcccgttgggcgaatgcgcaggacattcgcaag
gcgggcctcacgcagccggtcggcgtgttcctcggccagtacgatcgccagtacctgcgc
catgaagggccagagcatgttctgaccttcgcgcccacacgctcgggcaagggcgtcggc
ctggtggttcccaccttgttgagctggccggcctcggcggtcatccacgacatcaagggg
gagaactggcagatcaccgccggctggcgcagccgtttcagccactgcctgctgttcaac
ccgaccgatgcaaagtcggcggcctacaacccgctgctggaggtacggcgcggcgcgcat
gaagtgcgcgacgtgcagaacatcgcggacattctagtcgatcccgaaggcgcgctggag
aagcgcaaccattgggagaagacctcgcacgcgctgctggtcggggcgatcctgcatgtg
ctctatgcgggcgaggacaagacgctgcgcggcgtcgccaacttcctcagcgacccggcc
agccccttcgagctgaccttgcaccggatgatgaccacgccccacctgggcgatgggccg
catccggtggtggcatccgctgcgcgcgaagtgctcaacaagtcggacaacgagcgttct
ggcgtcttgagcaccgccatgtcgttcctcggcctgtaccgcgatcccacggtggccgaa
gtcacgtcgcgctgcgactggcgcattgccgacctcatatccgccgagcatcccgtatcg
ctgtacctggtggtgccgccttcggacatttcgcgcaccaagccgctcatccgcctgatc
ctcaaccagatcgggcggcgcttgaccgaatcgctcgacggctctgacggcatcgaacgc
cgccacaagctgctgctgatgctcgatgagtttccggccctgggccggctcgacttcttc
gagacggcgctcgcattcatggcgggctacggcatccgcagcttcttgattgcgcagtcg
ctcaaccagatcgacaaagcctacggccagaaccattcgattctggacaactgccatgtg
cgcgtgacgttcgccacgaacgacgagcgcaccgccaaacgcatctccgagacgctgggc
acggccaccgagctgcgcgcacagcgcaactacgcgggccaccggctcgcgccgtggctg
gggcacctcatggtgtcgcgccaggagacggcccgcccgctgctgacaccgggcgaagtc
atgcagcttccgcccgatgaggcggtggtgatggtgtccagcgtggcgccgatcaaggcc
cggaagctgcgctattacgccgacgccaatttcaagcggcgcgtgttgccgccgcccgcg
ctggcggactgccaatacgccgacgcgccgccgctgcgcgccgacgactggagcgggctg
gcaatcccaccaacgcccaccgcaccagccacggcatccgccgatggcctcggttccgcc
gacgacggcggcccacgccgtcagcccgaactctccgaagccgtcgcctacgaccccgag
ctggccgcgcccgcggccgacctcggtttgctcgatgacgacgacgacctgccgcttccc
cttcctcgccagcttgatccggccatgcagcgcacggcccggctggcttccctcgacccc
aacgacggaattgagctatga

DBGET integrated database retrieval system