KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_31170Help
Entry
PA14_31170        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABJ11764
UniProt: A0A0H2ZAM7
Position
2709230..2709337
Genome map
AA seq 35 aa AA seqDB search
MFKGRQAQRGGDSPQGFPLEASKARSAARREGVRD
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaggggcgccaagcgcagcgcggcggggatagcccgcagggctttcccctggag
gcaagcaaagcgcgcagcgccgccaggcgcgaaggcgtgagggattga

DBGET integrated database retrieval system