KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_31220Help
Entry
PA14_31220        CDS       T00401                                 

Definition
(GenBank) hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABJ11760
UniProt: A0A0H2ZBR9
Position
complement(2714625..2714903)
Genome map
AA seq 92 aa AA seqDB search
MSSHHDYIIEITAQHDALKPFAPENGQPLRFKIGDAVIYTNEYGVQFRRCVTGFYRPSGL
CGHYARGARYLLNSTSPWVPVAESSLRPDDSA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccatcacgactacatcatcgaaatcaccgcgcaacacgatgcgctcaagcca
ttcgcgccggagaacggccagccgctgcgcttcaagatcggcgatgcggtgatctacacc
aacgaatacggcgtgcagttccgtcgctgcgtcaccgggttctaccggccgagtggcctt
tgcggtcactacgcgcgtggagcgcgctatctgctgaactcgacttcgccgtgggtgccg
gttgcggaatccagcctgcgtcctgacgactcggcctga

DBGET integrated database retrieval system