KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_32650Help
Entry
PA14_32650        CDS       T00401                                 

Definition
(GenBank) probable glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00350  Tyrosine metabolism
pau00643  Styrene degradation
pau01100  Metabolic pathways
pau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PA14_32650
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PA14_32650
Enzymes [BR:pau01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PA14_32650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 DUF599 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABJ11653
UniProt: A0A0H2ZAE0
Structure
PDB: 

Position
complement(2835508..2836152)
Genome map
AA seq 214 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLDYQVVPVNLRQGEQLRPADRQRNPLGALPTLVDADG
RRFSQSLAIIDYLDAVQPEPRLIPLDPLHRAQALELALLVACDIHPLNNVRVLKYLTQVL
GIDAEDRQRWYAHWVAEGLAAAETLLNRHRRGAFFAGTAAGIVECCLVPQLANARRMGCV
LAPYPALLELEGRCLALEAFQRASPERQPDYLPD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacagcttcttcaacagctccacgtcctatcgggtgcgtatcgcattggcc
ctgaaaggtctggattaccaggtagtgccggtcaacctgcggcagggcgagcaactgcgc
ccggccgaccgccagcgcaacccgctgggcgcgctgccgaccctggtcgacgccgacggc
cgtcggttcagccagtcgctggcgatcatcgactacctcgacgccgtgcagcccgaaccg
cgcctgatccctctcgacccactgcatcgcgcccaggcgctggaactggccctgctggtg
gcctgcgacatccatccgctgaacaacgtgcgggtgctcaagtacctgacccaggtcctc
ggcatagacgccgaggaccgccagcgctggtacgcgcactgggtcgccgagggcctggcg
gcggcggagaccctgctgaaccgacaccgtcgcggcgccttcttcgccggcaccgcagcg
ggcatcgtcgagtgctgcctggtgccgcaactggccaacgcccggcgcatgggctgtgtc
ctggcgccctacccggcgttgctcgaactggaggggcgctgcctggcgctcgaagccttc
cagcgcgccagccccgagcgccagcccgactacctcccggactga

DBGET integrated database retrieval system