KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_34000
Entry
PA14_34000        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_34000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_34000
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_34000
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABJ11546
UniProt: A0A0H2ZB57
Position
complement(3023891..3024907)
AA seq 338 aa
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLL
PLFASSEVESLLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRSRQKDHAPAEFLDLF
QHRLLSLLYRVLRKHRVALGFAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTA
LFAGGRRSLAGFAGLVRQHFGVEARLDAYQGAWKEIPAASRSRLQRGGRNLRLGRDAIAG
TRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAALYFGPDLDCRLSLLVSGGAP
LRLERGAPPRLSWNTGLRRVEDGQRQRIDLDLRQPEVA
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcaaccccaggccggctcgccgctctccctctgagccaacggctgcgccgcacgccg
cagcgcttcgaactgttgcaggcgctgctgctgctcgaacgcgagcgtccccaggcgttg
ccgctgggcaccggcaacgcgccgcgggcggaggccctgcgcctgcgcgggccgctgctg
ccgctgttcgcctcgagcgaggtggaaagcctgctcgacgacccgcagcaaccggtgctg
tccaccccggtgttcggcctcggcggccccgacggcccgttgccctatgcctaccaggaa
tggctgcaacagcgttcccggcagaaggaccatgcccccgccgagttcctcgacctgttc
cagcaccgcctgctcagcctgctctaccgggtgctgcgcaagcatcgcgtggcgctcggt
ttcgcggtgccggcggcgaccccggtgcaggcgcagctacgcgccctcagcggcctgttg
ccgaaagccctgcaagagcgcctggcgctgccggacagcgcggtactggcacgcaccgcg
ctgttcgccggcgggcgtcgctccctggccggcttcgccggcctggtgcgccagcatttc
ggcgtggaggcacggctggacgcctaccagggcgcctggaaggaaatccccgcggccagc
cgcagccggctgcaacgcggcggacgcaacctgcgcctgggtcgcgacgccatagccggc
acgcgcacctgggacgagcacgccggcatcgccctcagtctcggtccgctggatgcccgc
gaagccgcccgcttcttccccgacggcgacgcccatggccagttggccagcctcgccgcg
ctgtacttcggccccgacctggattgtcgcctgagcctgctggtgagcggcggcgcgccg
ctgcgcctggagcgcggtgcaccgcccaggctgagctggaacaccggcctgcggcgcgtc
gaagacggccagcggcagcgcatcgatctcgacctgcggcagccggaggtagcctga

DBGET integrated database retrieval system