KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_34140
Entry
PA14_34140        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_34140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_34140
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_34140
SSDB
Motif
Pfam: ImpA_N ANTH
Other DBs
NCBI-ProteinID: ABJ11536
UniProt: A0A0H2ZB49
Position
3036369..3037469
AA seq 366 aa
MTLPLSGNALSLEVLLEPIAPEQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKR
ADWAAVEQLASELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHP
QAQDGDQSWRVPPIDWLLRRYAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKS
AKAALEAAQLQQKKLDEALRAEPLVQWQRKQASLLACQQQLQRLEQWCDRCLGELAPSCQ
PLREVIAQWLALLKEFIAMHPQAPLPEEQPPVAEADAAEGDADGEESVPASAPSGPAGAP
TSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELINADSEARRVWS
LLGVLP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaccctgcctctttccggcaacgccctgtccctggaagtgctgctcgaacccatcgcc
ccagaacagccgtgcggccccagcctgcgctacgacccggactacgaccgcctgcgcgag
ttgcgccgggaggacgacagcagcctgccgaccggcgtctggcaggcggaggccaagcgc
gccgactgggccgcggtggagcagttggccagcgaactgttgcagcggcgcagcaaggac
ctgatgctcgccgcctggctcggcgaggcctggctgcaacgcggcgggctgggcggattg
cagcgcgcgctggtgctgctggcggaactctgcgagcgctaccccgaggaggtgcatccg
caagcccaggacggcgaccagtcgtggcgggtgccgcccatcgactggctgttgcgccgc
tatgccgagctgctgcacacgcgcctgccgctgatggggcagggcgccttcgccgagatc
accctctatgcctggcagaggttgcagcgccagcaggtcgccagcggcgacagcaagagc
gccaaggcggcgctggaagcggcgcaacttcagcagaagaagctcgacgaagcgttgcgc
gcggagcccctggtgcaatggcagcgcaagcaggccagcctgctcgcctgccagcagcaa
ctgcaacgcctggaacagtggtgcgaccgctgcctgggcgaactcgcccccagttgccag
ccgctgcgcgaggtcatcgcgcaatggctggccttgctcaaggagttcatcgccatgcac
ccgcaagcgccgctgcccgaagaacagccaccggtcgcagaggcggacgccgccgaaggc
gacgcggacggcgaggaaagcgtcccggcgagcgcgccgagcgggccggctggcgcgccg
accagtcgcgaggacgcctaccggcaactgctgctgatcgccgactacctggcgcgcacc
gagccgcacagcccggttccctacctgatcaagcgcgcggtggaatggggcaacaagccg
ctgagcgagctgctggcggagctgatcaatgcggactcggaggcgcgccgggtctggtcg
ctgcttggcgtactgccctag

DBGET integrated database retrieval system