KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_38630Help
Entry
PA14_38630        CDS       T00401                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00071  Fatty acid degradation
pau00072  Synthesis and degradation of ketone bodies
pau00280  Valine, leucine and isoleucine degradation
pau00310  Lysine degradation
pau00362  Benzoate degradation
pau00380  Tryptophan metabolism
pau00620  Pyruvate metabolism
pau00630  Glyoxylate and dicarboxylate metabolism
pau00640  Propanoate metabolism
pau00650  Butanoate metabolism
pau00900  Terpenoid backbone biosynthesis
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
pau01212  Fatty acid metabolism
pau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA14_38630 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PA14_38630 (atoB)
   00640 Propanoate metabolism
    PA14_38630 (atoB)
   00650 Butanoate metabolism
    PA14_38630 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PA14_38630 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PA14_38630 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_38630 (atoB)
   00310 Lysine degradation
    PA14_38630 (atoB)
   00380 Tryptophan metabolism
    PA14_38630 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA14_38630 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA14_38630 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA14_38630 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pau04147]
    PA14_38630 (atoB)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA14_38630 (atoB)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_38630 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DSBA
Motif
Other DBs
NCBI-ProteinID: ABJ11188
UniProt: A0A0H2ZA83
Position
complement(3445941..3447122)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAG
SGQNPARQAAIKAGLPVGVPAMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSL
APYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGITAENLAEKYGLTREEQDAFAA
ASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRA
LDKAGWSLEQLDLIEANEAFSAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALTLARD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtcgccgctacccgtaccgccgtcggcagcttccagggctcg
ctggccggcattcccgcccccgagctgggcgccgcggtgatccgccgcctgctcgaacag
accggtctcgatgccggccaggtcgacgaagtgatcctcggccaggtgctcaccgccggg
tccgggcagaacccggcgcgccaggcggcgatcaaggccggcctgccggtcggcgtgccg
gccatgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcgtcgccggcggccaggagaacatgagcctg
gcgccctacgtcatgcccggcgcccgcaccggcctgcgcatgggccatgcgaagctggtc
gacagcatgatcgaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggcggagaagtacggcctgacccgcgaggagcaggacgccttcgccgcc
gcttcgcagcagaaggccatcgccgccatcgagggcgggcgcttccgcgacgagatcacg
ccgatccaggtcccgcagcgcaagggcgagccgctgagcttcgataccgacgagcagccg
cgcgccggcaccaccgtcgaggccctggccaagctcaagccggccttcaggaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgccgcggtattgctgatg
agcgcagccaaggccaaggccctgggcctgccggtgctggcgcggatcgccagctacgcc
agcgccggggtcgacccggcgatcatgggcatcggcccggtctccgccacccgtcgcgcg
ctcgacaaggccggctggagcctggagcaactggacctgatcgaggccaacgaggccttc
tccgcgcagtccctggcggtgggccgggagctgggctgggatgccgccagggtcaacgtc
aacggtggcgccatcgcccttggccacccgatcggcgcgtccggctgccgggtgctggtg
accctgctgcacgagatgatccgtcgcgacgcgaagaagggcctcgccaccctgtgcatc
ggcggcgggcagggcgtcgccctgaccctggcccgcgactga

DBGET integrated database retrieval system