KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_42500Help
Entry
PA14_42500        CDS       T00401                                 

Gene name
pcrD
Definition
(GenBank) type III secretory apparatus protein PcrD
  KO
K03230  type III secretion protein V
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_42500 (pcrD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_42500 (pcrD)
Secretion system [BR:pau02044]
 Type III secretion system
  Type III secretion core apparatus
   PA14_42500 (pcrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHIPEP DUF3626
Motif
Other DBs
NCBI-ProteinID: ABJ10889
UniProt: A0A0H2Z9M9
Position
complement(3783280..3785400)
Genome map
AA seq 706 aa AA seqDB search
MNDLSGLLGRVGERKDILLVVLLLAVVFMMVLPLPPLLLDILIAVNITISVVLLMMSVYI
GSPLQFSVFPAVLLITTLFRLALSVSTTRMILLQADAGQIVNTFGSFVVGGNLVVGIIIF
LIITIVQFLVITKGAERVAEVSARFSLDAMPGKQMSIDGDMRAGVIDVNEARARRAVIEK
ESQMFGSMDGAMKFVKGDAIAGLIIIVVNILGGIAIGVTQKGLSTADALQLYAVLTVGDG
MVSQVPALLIAITAGIIVTRVSSDESADLGSDIGEQVVAQPKALLIGGLLLVLFGLIPGF
PTLTFLALALLVGGGGYFMLWRQRLQASAGSRDLPALLAQGAGAPSAKARGKAGGGKPKA
GRLAEQEEFALTVPLLIDVDASLQERLEAMSLNEELVRVRRALYLDFGVPFPGIHLRFNE
AMGDGEYLVQLQEVPVARGCLRPGWLLVRERAAQLELLAVPHEPAELQVPGEEASWVEQA
HQDRLERSGCACLGLEQVLTWHLSHVLREYAEDFIGIQETRYLLEQMEQGYGELVKEAQR
IVPLQRMTEILQRLVGEDISIRNMRAILEAMVEWGQKEKDVVQLTEYIRSSLKRYICYKY
SSGNNILPAYLLDQAVEEQIRGGIRQTSAGSYLALDPAITQAFLERVRQTVGDLAQMQNR
PVLIVSMDIRRYVRKLVESDYAGLPVLSYQELTQQINIQPLGRIVL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgagcgggcttctcggccgggtcggcgagcgcaaggacatcctgctggtg
gtgttgctgctggcggtggtgttcatgatggtgctgccgttgccaccgctgctgctggac
atcctcatcgccgtcaacatcaccatctccgtggtcctgctgatgatgtcggtgtacatc
ggctcgccgttgcagttctcggtgttcccggcagtgctgctgatcaccacgctgttccgc
ctggcgctgtcggtgagcaccacgcggatgatcctgctgcaggccgacgcggggcagatc
gtcaacaccttcggcagcttcgtggtcggcggcaacctggtggtgggcatcatcatcttc
ctgatcatcaccatcgtgcagttcctggtgatcaccaagggtgccgagcgggtcgccgag
gtcagcgcgcgcttttccctggatgccatgccgggcaagcagatgagcatcgacggcgac
atgcgtgccggcgtgatcgatgtcaacgaggcgcgggcgcggcgcgcggtgatcgaaaag
gaaagccagatgttcggctctatggacggcgcgatgaaattcgtcaagggcgacgccatc
gccgggctgatcattatcgtcgtcaacatcctcggcggcatcgccatcggcgtcacgcag
aagggcctgagcaccgccgacgcgctgcaactgtacgcggtgctgaccgtcggcgatggc
atggtctcgcaggtgccggcgttgctgatcgccatcaccgccgggatcatcgtcacgcgg
gtgtcttccgacgaatcggcggacctcggcagcgacatcggcgaacaggtggtggcgcag
cccaaggcgctgctgatcggcggcctgttgctggtgctgttcggcctgattcccggtttc
ccgaccctgaccttcctggctctcgcgctgctggtcggcggcggcggctacttcatgctc
tggcgccagcggctccaggccagcgccggttcccgcgacctgccggcgctgctcgcgcag
ggcgccggagcgccatcggccaaggcgcgcggcaaggctggcggcggcaagccgaaggcc
gggcgtctcgccgagcaggaagaattcgccctcaccgtgccgttgctgatcgacgtcgat
gccagcctccaggaacgtctggaggcgatgtcgctgaacgaggaactggtgcgggtacga
cgcgcgctgtacctggatttcggcgtgccgttcccgggtatccacttgcgcttcaacgaa
gcgatgggcgatggcgaatacctggtgcagctacaggaggtcccggtcgcgcgcggatgc
ctgcggccgggctggttgctggtgcgcgaacgcgccgcgcagctggaattgctcgcggtc
ccccacgagccggcggagctgcaggtgccgggagaggaagcgagctgggtggagcaggcg
catcaggatcgcctggagcgttccggctgtgcctgcctgggcctggagcaggtgctcacc
tggcacctgtcccatgtgctgcgggagtacgccgaggatttcatcggcatccaggagacg
cgctacctgctggagcagatggagcagggttacggcgagctggtgaaggaggcacagcgg
atcgttcccctgcagcggatgaccgagattctccagcgcctggtcggcgaggacatctcg
atccgcaacatgcgggcgatcctcgaggcgatggtggagtgggggcagaaggagaaggac
gtggtgcagctcaccgagtacatccgcagcagcctcaagcgctacatctgctacaagtac
tccagcggcaacaacatccttcccgcctatctgctggaccaggcggtggaggagcagatc
cgcggtggcatccgccagaccagcgccggcagctacctggccctcgacccggcgataacc
caggccttcctcgagcgcgtgcggcagaccgtcggcgatctcgcgcagatgcagaaccgg
ccggtgctgatcgtttccatggatatccgccgctacgtgcgcaagctggtggagagcgac
tatgccgggctgccggtgctgtcctaccaggagctgacccagcagatcaacatccagccg
cttggcaggatcgtgttgtga

DBGET integrated database retrieval system