KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_42900Help
Entry
PA14_42900        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_42900
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_42900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_42900
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_42900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_29 SRC-1 DUF4131 AAA_21
Motif
Other DBs
NCBI-ProteinID: ABJ10854
UniProt: A0A0H2Z9K1
Position
complement(3812214..3815741)
Genome map
AA seq 1175 aa AA seqDB search
MKNFFKKVGAFLRKTWVWTLLLVLLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFL
VWGLAMVFVSWRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLY
RGRSERWRNELPWYLLIGPQGSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFAD
HGVLIDTAGRYLTQADGEVDGGAWATLLGLLRKRRRARPLNGVMVSIPVETLLSDDEMAL
DTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEFFDQLSREESDQVLGTSFGKE
QNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQIGERLCLFVEL
AFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERVRE
LAQQWAQQRQALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLT
AAYRRELETQLLPRVARMLEAQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVAT
DWSQRYAGNGTVQNGLNTHFARLLEQPFSYPLNDTLVAQARQVLRSESLANVVYRVLREQ
ARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYFVVQGASLVNDILRDNWVLGE
GSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQVSGLLAANSPI
LQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRM
GGQRDALSNLRNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAI
NKRYPFNAHSASDVAVSDFREFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPM
SKVYLDQMGTAQVIRQSFFAENPAEPQVRFRLEPYTLDPGVSRAEFRFDGQSMEYRHGPI
VPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLFRLFDLMQTEYLSGRDVMVLK
ADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacttcttcaagaaagtcggcgccttcctgcgcaagacgtgggtctggacgctg
ctgctggtactcctggcggcattgctggtgtggttcgtcgggccgctgctggcggtcgcc
gactacaagttctgggaaagcccgacctcgcggttgctgagcatcagtctgatgttcctg
gtctgggggctggcgatggtcttcgtcagctggcgcgccggagtgcggcgcaaggccgtc
gaggacagcgacgagggccaggagcgcctgcgccgtgacggtctgatcgaagacgaacag
aaggaattgcgcagccgcttcaaggacgccttgcgcaccctgaagacctccagcctgtac
cgcggtcgtagcgagcgctggcgcaacgagctgccctggtacctgctgatcggcccgcag
ggaagcggcaagaccagcctgctggacttttccggactggagttcccgatcaaccggatc
gaccgcaagctgacccgcgataccgccggcacgcgctactgcgactggtacttcgccgac
cacggcgtcctgatcgacaccgccgggcgctacctgacccaagccgacggcgaggtcgac
gggggcgcctgggcgaccctgctcggcctgttgcgcaagcgccgccgcgcacggccgctg
aatggcgtgatggtgtcgattccggtggaaacgttgctcagcgacgacgagatggcgctg
gatacgctggctcgccaggtgcgcgcgcgcctgcaggaaatccagcagaccctgcacctc
gatctgccggtctacctggtgctgagcaaggccgaccagttgctcggcttcgacgagttc
ttcgaccagttgagccgcgaggagagcgaccaggttctgggcaccagcttcggcaaggag
cagaacggcaccgatgtgacggtcctgcgccaggcgttcgaggaccttctgcgacgcctg
aacagccaggtgatcatgcgcatccaccaggagcgcgatactctgcgtcgcggtcgcatc
ctcgacttcccgcaccagcttggccagatcggcgagcggttgtgcctgttcgtcgaactc
gccttcaccggcaatcgctaccagcgcgccagccgcctgcgcggcttctacctgaccagc
gcgccgcacctggcccagcagctggatgaggacaccgccggcatcggcgccaacctgggg
atcgccagcggcctgctgccgaccctgcgcaacgggcgctcgcgcttcatccatcacctg
ctgagccaggtgatcttccccgaggccaacctggcaggtctcgatcgccgcgagcgcacg
cgcatccactggggccagcgcgccctgtacgtcggttcgctggcgctccttctgctattc
ggcctgctctgggctggcggtttctcggccaaccacgagcgcctggagcgggtccgcgag
ctggcgcagcaatgggcccagcagcgccaggcgcttggcgagcgcgacgacgccatggcg
gcgctgaagacgctggatagcagctatgcggcgaccaccgtgtttccgcccaaaggcgaa
gtctcgctgcacgagcgcgccgggctgtaccagggcaacgaggtcaacccgccgctgacc
gctgcctatcgccgcgagctggagacgcaactgctgccgcgcgtggcgcggatgctcgaa
gcgcagatccgcggcaacatgcagaatcgcgaacgcctgctcaacagcctgcgggcctac
ctgatgctgaatctgcgcgagcgccgcgagaacggatggctcaaggactgggtggctacc
gactggtcgcagcgctatgccggcaacggcaccgtgcagaatggcctgaacacgcatttc
gcccgtctgctcgagcaaccgttcagctatccgctgaacgacaccctggtggcccaggca
cgccaggtgctgcgcagcgagtccctggccaacgtggtctaccgggtgctgcgcgaacag
gcgcgaagcctgcccgagtatcgcttcggccagcacctggggccgcaggccggtctgttc
gtcggcaccgactacgtgatcccggggttctacacccagcagggctaccagcagtacttc
gtggtccagggcgccagcctggtcaacgacatccttcgcgacaactgggtcctgggcgag
ggcagcgggatcagcgacatggacctgcggcgcctgatggtcgaactcgagcagttgtat
ttccgcgactacgcgaacttctggagcgaggcggtcggacgcctgggcctgctgccgttc
aacgatgccggcgagggcgccgaccaggtttccgggctgctcgccgccaactcgccgatc
ctccagttgttgctggaggtccgtgagaacacccgtttcccggtcctggcggagagcgcc
gaggcgctggcagaggccagcgacaaggccgcggaaaagggcggcaagctgggcaaggcg
gccgccgcggcggccggcaaggccagggacgcgttggcgaagaacctgccggataccgcg
aagaagtccctgcaacgccgcttcgagcccctgcatcgcctgctcgacgataacaacggc
ccggcggccgacctcaccccgctgttgcaggcgctcaacgagttgcagttgcaactcgcc
ggactggcgcgcgccagccagccggagcaggcggctttcgacatggcgaagagccgcatg
ggcggccagcgcgatgccctgagcaacctgcgcaacgcctccgcgcgactgccgcgaccg
ctcggcggatggttcagcgtgctggccgaagacgcctggcggctggtcctcggcgatgcc
tacctgtacctcaaccagcgctaccagagcgagctgtacggtttctacagcaaggcgatc
aacaagcgctacccgttcaacgcgcacagcgccagcgatgtcgcggtcagcgatttccgc
gagttcttcaaggcgcagggcgtcgccgaacgcttcttcgaaacctacatgcggcccttc
gtcagcggcgacccgggcagctaccgcctgcgcagcgtggacggctacagcctgccgatg
tccaaggtctatctcgaccagatgggcacggcccaggtgattcgccagagcttcttcgcc
gagaacccggccgagccgcaggtgcgcttccgtctggagccctataccctcgatcctggc
gtcagccgcgccgagttccgtttcgacggtcaatccatggaataccgccacggcccgatc
gtgccgatgtcgttcaagtggcccagcgacgccgacggcggccgcaccagcctggtgctg
gagaagatggccgggcgaccggtgggaatcgaacgcaataccgggccctggtcgctgttc
aggctgttcgacctgatgcagaccgagtacctcagcgggcgtgacgtgatggtgctcaag
gccgacctgggcggcctgcgcgccaactacctgctgctcgcccagcgcacgccgaatccg
ttcgatctcgcggtcctgcgcagcttccgcatgccggtgcagctctga

DBGET integrated database retrieval system