KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_43030Help
Entry
PA14_43030        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pau00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_43030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_43030
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_43030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: ABJ10843
UniProt: A0A0H2Z9C1
Position
complement(3827587..3829062)
Genome map
AA seq 491 aa AA seqDB search
MSTSAAQQGRNQNGEYNILDSIIAETRLSPDDEAYDIAKRGVSAFIEELLKPQNDGEPVK
KAMVDRMIAEIDAKLSTQMDEILHHPDFQALESAWRGLQLLVDRTNFRENIKIEILSVSK
QDLLDDFEDSPEVMQSGLYKHIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSV
ACMAHAPFVAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFAKWQSFRQSEDSRYVALTVP
RFLLRTPYDPEENPVKSFAYKETVANSHEHYLWGNTAYAFGTKLTDSFAKYRWCPNIIGP
QSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRKGSDNAAFFSA
SSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQIIVSDVEGEPGWYRVSLNVRPHFKYMGADF
TLSLVGKLDKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagtgccgcacagcaaggccggaaccagaacggcgaatacaacattctcgac
agcatcatcgccgagacccgcctgagcccggacgacgaggcctacgacatcgccaagcgc
ggcgtctccgccttcatcgaggaattgctcaagccgcagaacgacggcgagccggtgaag
aaggcgatggtcgaccggatgatcgccgagatcgatgccaagctcagcacgcagatggac
gagatcctccatcatcccgatttccaggcgctggagtcggcctggcgcggcctgcaactg
ctggtcgaccgcaccaacttccgcgagaacatcaagatcgagattctcagcgtttccaag
caggacctgctggacgatttcgaggactcgcccgaggtgatgcagtccggcctgtacaag
cacatctacaccgccgaatacggccagttcggtggccagccggtcggcgccatcatcgcc
aactactacatgtcgcccagttcgcccgacgtcaagctgatgcaatacgtctccagcgtg
gcctgcatggcccatgcgccgttcgtggcggccgccggtccgaagttcttcggcctggaa
agcttcaccggcctgccggacctgaaggacctgaaggatcatttcgaaggcccgcagttc
gccaagtggcagagcttccgccagtccgaggattcccgctacgtggcgctgaccgtaccg
cgcttcctgctgcgcacgccctacgatccggaagagaatccggtcaagtcgttcgcctac
aaggagaccgtggccaatagccatgagcattacctgtggggcaacaccgcctatgccttc
ggcaccaagctgaccgacagcttcgccaagtatcgctggtgcccgaacatcatcgggccg
cagagcggcggtgcggtggaggacctgcctttgcaccacttcgagagcatgggcgagatc
gagaccaagatccccaccgaggtgctggtgtccgatcgccgcgagtacgaactggccgag
gaaggcttcatttccctgaccatgcgcaagggcagcgacaacgccgcgttcttctccgcc
agctcggtgcagaagccgaagttcttcggcatcagcgccgaaggcaaggccgcggagctg
aactacaagctcggcacccagttgccgtacatgatgatcgtcaaccgcctggcccattac
ctgaaggtcctgcaacgcgaacagctggggtcgtggaaggagcgtaccgacctcgagctg
gagctgaacaagtggatccgccagtacgtcgccgaccaggaaaaccccagcgccgaagtg
cgcggccgtcgcccgctgcgcgctgcacagatcatcgtcagtgacgtcgagggcgagccg
ggctggtaccgcgtcagcctgaacgtgcgcccgcacttcaagtacatgggggcggacttc
accctgtcgctggtcggcaagctggacaaagagtaa

DBGET integrated database retrieval system