KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_43100
Entry
PA14_43100        CDS       T00401                                 

Definition
(GenBank) putative Rhs family protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: RHS_repeat RHS MerR FdhE OCRE
Other DBs
NCBI-ProteinID: ABJ10837
UniProt: A0A0H2Z8A2
Position
3835369..3840213
AA seq 1614 aa
MISSFYAMFMLRGVNAKQPDASQLIGEFSSGVLNRYEEYANSWLWGWALDVQQTIALSDG
NGNELTRLKADKDANILEDVASCPVNGQLKLLHTFESTSFVPIGNTPYEITRIGSRTPQF
KGVLDADGMASISGCAPNTLYQVKFYPEVSIQEIDALYRSYDDVIAKLNEWLLEQWNGPL
SAEWKRLAPVGDRRRMEQINDAYLDGMGKALVNLWDDVVELFGILANLDEHAAKLLEFIN
EADFEKLKAQAKELLGTALLIASDEPLLFIYASAIVCWTQLLPPTTAAEMVAELSTGLLL
DILLGIILTGGAGLAVRLAVKGSKAIKASEGAMLLRKAMQVLIDTSCRHSLQLHAEKLKP
LAVRGEVMANSSNKITAQIQSTAQGIARTEHDTLPLSRGKRANTSLSSSQATPDASAPGR
TPAGKPADQAAQTCVKDCPVSMVTGEELLTLTDCELDGPLRFAWTRLYRTSAAEIDNGLG
FGWSHALSHRLDRDGDELVWTDHENRRTRFPIPDAQRPAITNRLSRAAIYLGGDPSELIL
AQAGEKPRFYHFRKDPDGAYLIAISDAYGNRLELSRDRLGRPRRLSHKAGRALLLCYQGR
HIERVEYQVYQPADNLEACWHTTQVLARYRCNERGQLIEAGNALYEAERYRYDARNVILE
RQLAGGASFFWEWEGEGKQARAVHHWASFPQMDSRYVWNEDGSVTAINADGSEEVYVHDD
NARLVRQVDPDGGETLRHYDEKGQLVAERDPLGTITEYRYDQAGRLEALLPAEGEPTCYS
YFDGFVRSVRRGEAQWKYERNTQGDITRQTDPEGNVTHYAYDHRGCLVEITHADGSLHQL
TWNPLGQLIEEQLPDGSVRRYRYDTLGRQITRQDESGAITRFQWDAAGRLSQITLPGGAS
RMYRYNAYGKVTSECDEQGRMTRYEYLDDLHLVSRRINPDGSQLRYRYENARLLLSEIEN
ERGERYRLDYHGNGLISQETGFDGRRTAYRYDLKGQLLEKTEYGDDGSELRTTYQRDSTG
RLLAKTLPDGNRVDYRYDTLGRLVAVDDGTWPLAYEYDLRDRLVREHQGWATLHYAYDAL
GQLIHCRLPDGNRVDYRYQTGGTLSAIDLNGQSLTRHQFGSGRERQRQQGELLSQYHYDE
QGRLLAHQVSQRQRHLYQRQYRYDASGNLAAIEDSRKGIRSFHYDPLDRLLGVRGETPES
FVHDPAGNLLAQGGQFDARQMEVRGNRLLTQGDRHFDYDAHGNLVRERRGTGQKLVTEYS
YDCQHRLIGVSLPDGRQVVYRYDAFGRRIAKQVDGRNTEFLWLGERLLAESGDRHYRTYL
YEPDSFRPLALLDGEGPEQVEPCYYQLDHLGTPQELTRADGRLCWSARYRAYGNVLKLDI
AEVDNPLRFQGQYFDAETGLHYNRHRYYNPSTGRYLTPDPIRLAGGLNSYRYVPNPTGWV
DPLGLASNKTRCPEALDNNPRKGINSTSGSKKPAGPIVELDAQGNEIYYRTLSEQHLEIL
RNNFEVPPTSETFISPLQSYSQEYDGKLVRLTASPGTMNELSKIGVTANSGTGLLLPDLP
PARKGWKQNNALFKLEALKKPTINEGGGVINTGLGDGKALEIFNKNLIDFEVID
NT seq 4845 nt   +upstreamnt  +downstreamnt
atgatctcgtcgttctacgccatgttcatgctgcgcggagtgaacgcgaagcagccggat
gccagccagttgatcggcgaattcagctccggggtgctcaaccgctatgaggaatatgcg
aacagttggctctggggctgggcactcgacgtccagcagaccatcgccctttccgatggg
aacggcaacgagttgaccaggctgaaagccgacaaggacgccaacatcctcgaagacgtc
gcctcatgtccggtcaacggtcaactgaaactgctgcatactttcgaatcgaccagtttc
gtgcccatcggcaacacgccttacgaaatcactcggataggcagcaggacaccgcagttc
aagggcgtactggatgcagatgggatggcgagcataagcggctgcgctcccaatacgctg
taccaggtcaagttctacccagaggtaagcatccaggagatcgacgcgctctaccgctcc
tacgacgacgtaatcgccaagctgaacgagtggcttctggagcaatggaacggcccgctt
tccgccgaatggaaaaggctcgcgccggttggcgaccgtaggcggatggagcagataaac
gacgcctatctggacggcatgggcaaagcgctggtcaatctctgggatgatgtggtcgag
ctgttcggcatcctcgcgaacctcgacgagcacgcggcgaaactccttgagttcatcaac
gaagcggatttcgaaaagctcaaggctcaggccaaggaactcctcggtaccgccttgctg
atcgccagcgacgaaccgcttctgttcatctatgccagcgccatcgtgtgctggacccag
ttgctgccgcccacgactgccgcggaaatggtcgcggaactctccaccggcctgctcctc
gatattctgctcggcatcatcctgaccggcggagccggtctcgccgttcgcctggccgtc
aagggctcgaaagcaatcaaggcctccgaaggtgcgatgctgctgcgcaaagccatgcag
gtgctgatcgataccagctgtcggcattccctccagttgcacgcggaaaagctgaaacct
ctggccgtccgcggtgaagtgatggccaacagctccaacaagatcaccgcacagatccag
agcaccgcccaaggcatcgcccgcaccgagcacgacaccctgccgctgagccgaggaaag
cgcgcgaacacctcgctctccagcagtcaggcgacgcccgatgcctccgcacccggcagg
acgcccgccggcaaacccgccgaccaggccgcccagacctgcgtcaaggactgtcccgtt
tcgatggtcaccggcgaggagctgctgaccctgaccgactgcgagctggacggtccgctg
cgtttcgcctggacgcgcctgtaccgcaccagcgcggcggaaatcgacaatggtctgggc
ttcggctggagccatgccctctcccatcgcctcgatcgcgacggcgacgagctggtatgg
accgatcacgagaaccgccggacccgcttcccgatccctgacgcccagcgcccggcgatc
accaaccgactgtcgcgcgccgccatctacctcggcggcgacccatccgaactgatcctt
gcccaggccggcgaaaagccgcgcttctaccacttccgcaaagacccggacggcgcttac
ctgatcgccatcagcgacgcctacggcaaccgcctggaactgagtcgcgaccgcctcggc
cggccgcgccgcctcagccacaaggccgggcgcgcgctactgctgtgctaccagggcagg
cacatcgagcgcgtcgagtaccaggtgtaccagcccgccgataacctggaggcctgctgg
cacaccacccaggtactcgcccgctaccgctgcaacgaacgtggccagttgatcgaagcc
ggaaacgcactctacgaggccgaacgctatcgctacgacgcgcgcaatgtcatcctcgag
cgccagttggccggcggcgcctcgttcttctgggaatgggaaggcgaaggcaagcaggcc
cgcgcggtccatcactgggccagcttcccgcagatggactcgcgctacgtctggaacgaa
gacggcagcgttaccgcgatcaacgccgacggcagcgaggaagtctatgtccacgacgac
aacgcgcgcctggtacgccaggtcgatcccgacggaggcgaaaccctcaggcactacgac
gagaagggccaactggtcgccgaacgcgatccgttgggaacgatcaccgagtaccgctac
gaccaggccggacgcttggaggcactgctcccggccgaaggcgagccaacctgctatagc
tacttcgacggcttcgtgcgcagcgtgcgccgcggcgaggcgcagtggaagtacgagcgc
aacactcagggcgacatcacccgccagaccgatcccgaaggcaacgtcacccactacgcc
tacgaccaccgcggctgcctggtggaaatcacccatgccgacggcagcctgcaccagttg
acctggaatccgctcggccagttgatagaagaacagcttccggacggtagcgtgcgccgc
tatcgctacgacacactgggtagacagatcacccgccaggacgaaagcggcgccatcacc
cggttccagtgggatgcagcaggccgcctgagccagatcaccctgcccggtggcgccagc
cgcatgtaccgctacaacgcttacggcaaggtcaccagcgagtgcgacgaacagggccgg
atgacccgctacgaatatcttgacgacctgcacctggtcagccggcggatcaacccggac
ggcagtcagctgcgctaccgctacgaaaacgcccggctactgctcagcgagatcgagaac
gaacgcggcgaacgctatcgcctcgattaccacggcaacggcctgatcagccaggaaacc
ggcttcgacggccgccgcaccgcctatcgctacgacctcaaaggccagcttctggagaaa
accgagtacggcgacgacggcagcgaactgcgcaccacctaccagcgcgacagtaccggg
cgcctgctggcgaagacactgcccgacggcaatcgggtcgactaccgctacgatacgctc
ggacgcctggtcgccgtcgacgacggcacctggccgctggcctacgaatacgacctacgg
gaccgcctggtccgcgagcaccagggctgggccacccttcactacgcctacgacgccctc
ggccagttgatccactgccgactgcccgacggcaaccgcgtcgactaccgctaccagacc
ggcggcaccctctcggcaatcgatctcaacggccagtccctgacccggcaccagttcggt
agcggtcgcgaacgccagcgccagcagggcgaactgctcagccaataccactacgatgag
cagggccgcctgctggcccaccaggtcagtcagcggcagcgccatctctaccagcgccag
taccgctatgacgctagcggcaacctggccgccatcgaggacagccgcaagggcattcgc
agcttccactacgacccgctggaccgcctgctcggcgtacgcggtgaaaccccggaaagc
ttcgtgcacgacccggccggcaacctgctcgcccagggcgggcaattcgacgcgcgacag
atggaggttcgcggaaatcgcctgctgacgcagggcgaccggcatttcgactacgacgcc
cacggcaatctcgttcgcgaacgccgcggcaccgggcagaagctggtcaccgaatacagc
tacgactgccaacaccgcctgatcggcgtcagcctgccggacgggcgccaggtcgtctac
cgctacgacgccttcggccgacgcattgccaagcaggtcgacgggcgcaataccgagttc
ctctggctcggcgaacgcctgctcgccgagagcggcgaccggcactaccgcacctatctc
tacgaacccgacagcttccgcccgctggccctgctcgacggcgaaggcccggaacaggtc
gaaccctgctactaccaactcgaccacctcggtaccccgcaggaactgacccgcgccgat
ggccgcctctgctggtcggcgcgctaccgggcttacggcaatgtgctcaagctggacatc
gccgaagtggataacccactgcgcttccagggccagtatttcgacgccgagaccgggctg
cactacaaccgccatcgctactacaatccaagcacgggacgctacctgacccccgatccg
atcaggctggcaggtgggttgaacagctaccggtacgtgccgaatccgacggggtgggtg
gacccgttggggctggcctcaaataaaactcgctgtcccgaagcattagacaataatccc
cgcaaagggattaactccacatccggcagcaaaaagccggcaggaccaatcgtagagctg
gatgcgcagggaaacgagatttactaccgaacactaagcgagcagcaccttgagatactg
aggaacaactttgaagtacctccgacgagtgagaccttcatctccccgctacaatcctac
tcccaagagtatgatgggaaattagtaagacttacagccagtccaggcaccatgaatgag
ctgtctaaaattggagtaactgcaaattccggaaccggcctattgcttccagatctccct
cccgcccgaaagggctggaaacagaacaacgcactattcaaactcgaagcactaaaaaag
ccaacgataaatgaaggaggcggcgttatcaacactggccttggggatggaaaagcccta
gagattttcaacaagaacctaatagacttcgaagtaatagactag

DBGET integrated database retrieval system