KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_44000Help
Entry
PA14_44000        CDS       T00401                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase E2 subunit
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00020  Citrate cycle (TCA cycle)
pau00310  Lysine degradation
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Module
pau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA14_44000 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PA14_44000 (sucB)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PA14_44000 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF4813
Motif
Other DBs
NCBI-ProteinID: ABJ10767
UniProt: A0A0H2Z8W8
Position
complement(3915162..3916391)
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPAAQAAAPAAAGGDDAILSPAARKL
AEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAALAKPAAPAAEAPIFAAGDRVEK
RVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFMS
FFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEIE
GGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPM
AVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcggtcaagcgcgacgaactgatcgtcgacatcgag
accgacaaggtggtcatcgaggttctcgccgaggctgacggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggc
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggctgcccaggcc
gccgctccggccgccgctggcggcgacgacgccatcctgtccccggccgcgcgcaagctg
gccgaggaggccggcatcgatccgaacagcatcgccggcaccggcaagggcggtcgcgtg
accaaggaagacgtggtcgctgcggtcgaagcgaagaagaacgccccggccgccctggcc
aagcctgccgccccggctgccgaggcgccgatcttcgccgccggcgaccgtgtcgagaag
cgcgtgccgatgacccgcctgcgggccaaggtcgccgagcgcctggtcgaggcgcagtcc
gccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctgcgt
tcgaagtacaaggacctgttcgagaagaagcacaacggcgtgcgcctgggcttcatgtcc
ttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcttccatc
gacggcaacgacatcgtctaccacggctaccaggacatcggcgttgccgtttccagcgac
cgcggcctggtggttccggtactgcgtaacgccgagttcatgagcctggccgagatcgag
ggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaagacatg
accggcggcaccttcaccatctccaacggtggcgtgttcggttccctgctgtcgaccccg
atcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccgatg
gccgtgaacggccaggtggtgatcctgccgatgatgtatctggcgctgtcctacgaccac
cgtctgatcgacggcaaggaagcggtgagcttcctggtggcgatcaaggacctgctggaa
gatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system