KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_44890
Entry
PA14_44890        CDS       T00401                                 

Gene name
hcpA
Definition
(GenBank) secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02025  Biofilm formation - Pseudomonas aeruginosa
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_44890 (hcpA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA14_44890 (hcpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_44890 (hcpA)
Secretion system [BR:pau02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PA14_44890 (hcpA)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABJ10692
UniProt: A0A0H2Z8M3
Structure
PDB: 
3HE1

Position
4000090..4000608
AA seq 172 aa
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPT
GQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAII
VDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcaacccccgcctatatgtccatcaccggcaccaagcagggcctgatcaccgccggc
gccttcaccgaggactcggtcggcaacacctatcaggaaggccacgaggaccaggtgatg
gtccagggcttcaaccacgaagtgatcatcccgcgtgacccgcagtccggccagccgacc
ggccagcgcgtgcacaagcctgtggtcatcaccaaggtcttcgacaaggcctcgccgctg
ctgctggccgccctgacctccggcgagcgcctgaccaaggtcgagatccagtggtaccgc
acctccgccgccggcacccaggagcactactacaccaccgtcctggaagacgcgatcatc
gtcgacatcaaggactacatgcacaactgccaggacccgggcaacgcccacttcacccac
ctggaagacgtgcacttcacctaccgcaagatcacctggacccacgaagtctccggcacc
tccggctccgacgactggcgctcgccggtggcagggtga

DBGET integrated database retrieval system