KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_51050Help
Entry
PA14_51050        CDS       T00401                                 

Gene name
pcd
Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00010  Glycolysis / Gluconeogenesis
pau00053  Ascorbate and aldarate metabolism
pau00071  Fatty acid degradation
pau00280  Valine, leucine and isoleucine degradation
pau00310  Lysine degradation
pau00330  Arginine and proline metabolism
pau00340  Histidine metabolism
pau00380  Tryptophan metabolism
pau00410  beta-Alanine metabolism
pau00561  Glycerolipid metabolism
pau00620  Pyruvate metabolism
pau00625  Chloroalkane and chloroalkene degradation
pau00903  Limonene and pinene degradation
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
Module
pau_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_51050 (pcd)
   00053 Ascorbate and aldarate metabolism
    PA14_51050 (pcd)
   00620 Pyruvate metabolism
    PA14_51050 (pcd)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PA14_51050 (pcd)
   00561 Glycerolipid metabolism
    PA14_51050 (pcd)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_51050 (pcd)
   00310 Lysine degradation
    PA14_51050 (pcd)
   00330 Arginine and proline metabolism
    PA14_51050 (pcd)
   00340 Histidine metabolism
    PA14_51050 (pcd)
   00380 Tryptophan metabolism
    PA14_51050 (pcd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA14_51050 (pcd)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PA14_51050 (pcd)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PA14_51050 (pcd)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PA14_51050 (pcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABJ10191
UniProt: A0A0H2Z6J0
Position
complement(4535213..4536802)
Genome map
AA seq 529 aa AA seqDB search
MKTRNDVANKGRLSLPGKPTKTSGNEQPGEPHMIDGLLRSLGLDPNAFRDGELAVHTPID
GSRLAAVPLEGRAAVAAKVERAEQAFRAWRQVPAPRRGELVRLFGEELRRHKAELGELVS
WEAGKITQEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPGHHMRETWHPLGVVGVISA
FNFPVAVWSWNTALALVCGNSVVWKPSEKTPLTALACQALFERAARAFGGDAPAHLSQLL
IGDREAGEALVDDRRVALVSATGSTRMGREVAPRVAARFARCILELGGNNAMILAPSADL
DLAVRGILFGAVGTAGQRCTTLRRLIAHESVKDEIVERLKAAYSRVRIGHPLEGNLVGPL
IDERSYLAMQDALARAREEGGRVFGGERQLQERYPDAYYVSPAIVEMPGQTEVVRTETFA
PILYVVGYRDFDEALRLNNEVPQGLSSCIFTTDLREAELFQGAAGSDCGIANVNIGTSGA
EIGGAFGGEKETGGGRESGSDAWKAYMRRQTNTVNYSRELPLAQGITFD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcggaatgacgtggcgaataaaggtcgtttgtcgctcccgggcaaaccgact
aaaacgagcggaaacgaacagccaggagaacctcacatgatcgacggattgctgcgcagt
ctcggcctcgaccccaatgcttttcgcgatggcgagcttgccgtgcatacccccatcgac
ggcagtcgcctggctgcggtgccactggaggggcgcgccgccgttgccgccaaggtcgag
cgcgccgaacaggcgttccgtgcctggcgccaggtgccggcgccgcgccgtggtgaactg
gtgcggctgttcggcgaggaattgcgtcggcacaaggccgaactcggcgaactggtgtcc
tgggaggcgggcaagatcacccaggaaggcctcggcgaagtccaggaaatgatcgatatc
tgcgacttcgcggtgggcctctcgcgccagttgtacggtcttaccatcgcatccgagcgt
cccggccaccacatgcgcgagacctggcacccgctgggcgtggtaggcgtgatcagcgcg
ttcaacttcccagtcgcggtgtggtcgtggaataccgcgctggcgctggtctgcggcaat
tccgtggtctggaagccttcggagaagacccccctcaccgcactggcctgccaggcgctg
ttcgagcgtgccgcgcgggccttcggcggcgatgcgccggcgcacctgagccaattgctg
atcggcgaccgcgaggccggcgaagcgctggtggacgaccgtcgcgtcgccctggtcagc
gccaccggcagcactcgcatggggcgcgaagtggcgccgcgggtggcggcgcgtttcgct
cgctgcatcctcgaactgggcggcaacaacgcgatgatcctggcgccaagcgccgacctc
gacctggcggtgcgcggcatcctgttcggtgcggtgggcaccgccgggcagcgctgcacc
accttgcgccggttaattgcccatgagtcggtgaaggacgagatagtcgagcgcctcaag
gcagcctattccagggtccgtatcggtcatccgctggagggcaacctggtcgggccgctg
atcgacgaacgcagctacctggccatgcaggacgccctggcgcgagcccgcgaggagggg
ggacgggtgttcggcggcgagcggcaattgcaggagcgctatccggatgcctactacgtg
tcgccggccatcgtcgagatgccgggacagaccgaagtggtgcgcacggagaccttcgcc
ccgatcctgtacgtggtcggctaccgcgatttcgacgaggccctgcgcctgaacaacgag
gttccccagggactgtcgtcgtgcatcttcaccaccgacctgcgcgaggcggaactgttc
cagggcgcggcgggcagtgactgcgggatcgccaacgtcaacatcggcaccagcggggcg
gaaatcggcggggcgttcggcggcgagaaagagaccggcggcggtcgcgagtccggctcg
gacgcctggaaggcctacatgcgacggcagaccaacaccgtcaactattcccgcgagctg
ccgctggcacagggcatcaccttcgattga

DBGET integrated database retrieval system