KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_53000Help
Entry
PA14_53000        CDS       T00401                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00790  Folate biosynthesis
pau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA14_53000 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pau04147]
    PA14_53000 (phhB)
Enzymes [BR:pau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     PA14_53000 (phhB)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_53000 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABJ10031
UniProt: Q02I31
Position
4699090..4699446
Genome map
AA seq 118 aa AA seqDB search
MTALTQAHCEACRADAPHVSDEELPVLLRQIPDWNIEVRDGIMQLEKVYLFKNFKHALAF
TNAVGEISEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDEVAKTAEGRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactcacccaagcccattgcgaagcctgccgcgccgacgccccgcacgtcagc
gacgaagaactgcccgtgctgctgcggcagattccggattggaacatcgaagtccgcgac
ggcatcatgcaactggagaaggtctacctgttcaagaacttcaagcacgccctggccttt
accaatgccgtcggcgagatatccgaggccgaaggccaccatccgggcctgctgaccgag
tggggcaaagtcaccgtgacctggtggagccactcgatcaagggcctgcaccgcaacgac
ttcatcatggcggcgcgcaccgacgaggtagcgaaaaccgccgaggggcgcaaatga

DBGET integrated database retrieval system