KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_53790Help
Entry
PA14_53790        CDS       T00401                                 

Definition
(GenBank) probable haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00361  Chlorocyclohexane and chlorobenzene degradation
pau00625  Chloroalkane and chloroalkene degradation
pau01100  Metabolic pathways
pau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PA14_53790
   00361 Chlorocyclohexane and chlorobenzene degradation
    PA14_53790
Enzymes [BR:pau01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PA14_53790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like LPD22
Motif
Other DBs
NCBI-ProteinID: ABJ09964
UniProt: A0A0H2Z6Q9
Structure
PDB: 

Position
4769103..4769804
Genome map
AA seq 233 aa AA seqDB search
MRAILFDVFGTLVDWRSSLIEQFQALERELGGTLPCVELTDRWRQQYKPAMDRVRNGQAP
WQHLDQLHRQSLEALAGEFGLALDEALLQRITGFWHRLRPWPDTLAGMHALKADYWLAAL
SNGNTALMLDVARHAGLPWDMLLCADLFGHYKPDPQVYLGACRLLDLPPQEVMLCAAHNY
DLKAARALGLKTAFIARPLEYGPGQTQDLAAEQDWDLIASDLPDLHRQLAASA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatcctgttcgatgtgttcggtaccctggtggactggcgttccagcctgatc
gagcagttccaggcgttggagcgcgaactcggcggaaccctgccctgcgtggaactgacc
gaccgctggcgccagcaatacaagccggcgatggaccgggtacgcaacggtcaggcgccc
tggcagcacctcgaccagttgcaccggcagagtctcgaggccctggccggagagttcggc
ctggcgctggacgaggccctgctgcaacgcatcactggcttctggcaccgcctgcggccg
tggccggacacgctcgccgggatgcacgcgctgaaggccgactactggctcgccgcgctg
agcaacggcaacaccgcgctgatgctcgacgtcgcgcggcacgccgggctgccctgggac
atgctgctgtgcgccgacctgttcggccactacaagcccgacccgcaggtctacctcggc
gcctgccgcctgctcgacctgccgccgcaggaggtgatgctctgcgcggcgcacaactac
gacctcaaggccgcgcgcgccctcggcctgaagaccgcgttcatcgcccggccgctggaa
tacggccccggccagacccaggacctcgccgccgagcaggactgggacctgatcgccagc
gacctgccggacctgcaccggcaactggcggcctcggcctga

DBGET integrated database retrieval system