KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_59660Help
Entry
PA14_59660        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: ABJ13877
UniProt: A0A0H2ZH71
Position
5308761..5309342
Genome map
AA seq 193 aa AA seqDB search
MATSVVRALQLATLLVLVNIAQAAVDPPPAYKQIALPKGVPAEVLYSVALTESKVLLRGE
YVPWPWTLNVAGKSYYYATRTAACTALLAAINLYGAKSVDSGLGQVNIGWNGHRFSSPCE
SLDPYKNLDATSDILIEQRDALYASAPGRPVDWIQVAGRYHRPAGGAPAAKYRRTVSRHL
SQVLGVNLLVTNP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtctgtagttcgagccctccagttggccaccctgctggtcctggtcaacatc
gctcaggccgccgtggatccaccgccggcgtacaagcaaatcgccctgcccaaaggggtt
ccggccgaggtgctctactcggtcgcgctgaccgagagcaaggtcctgctgcgcggcgaa
tacgttccctggccctggacattgaacgtcgccgggaaatcttactactacgcgacccgc
accgccgcctgcacagcgctactcgcggcgatcaacctctacggggccaagagcgtcgat
tccggcctcggccaggtcaacatcggctggaacggacatcgtttctccagcccctgcgag
tccctggatccgtacaagaacctggacgccacctccgacatcctgatcgagcagcgggac
gccctgtatgcatccgccccgggaagaccggtggactggatccaagttgccggccgctac
caccgccccgccggcggcgcgcctgccgccaaataccgtaggacggtttcccgccacctt
agccaagttctcggcgtcaacctactggtgaccaatccatga

DBGET integrated database retrieval system