KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_59900
Entry
PA14_59900        CDS       T00401                                 
Name
(GenBank) conserved hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: DUF2895 FHBP_C
Other DBs
NCBI-ProteinID: ABJ13898
UniProt: A0A0H2ZH90
Position
5333604..5334263
AA seq 219 aa
MSFRKHTAQQQAHINTFRFITGFLCMVIVVLAYCVWEARKDLWIHIPPDLRSGSTRLWWD
IPPESVYAFGLYIFQQVQRWPKDGEVDYKGNLFRYAAYLTPSCKVFLEKDFEFRRNAGEL
RGRERTTSEIPGRGIGESNGRVIQHSINDWTVNLDMDSTEYYAGEKIKRALARYPLHVIR
ADVDPETNPFGLQWDCYSDTPQRIELEEPAAPTKREGGL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtttcagaaaacacactgcgcaacagcaggcacacatcaacaccttccggttcatc
accggcttcctgtgcatggtcatcgttgtgctggcctactgcgtctgggaagcccgtaag
gacctctggatccacattccgcccgacttgcgctcaggaagcacccggttgtggtgggac
attccgccagagagcgtctatgcgttcggcctctacatcttccagcaggtgcagcgttgg
cccaaggacggcgaggtggactacaagggaaacctgttccgctacgctgcctacctcact
ccctcctgcaaagtcttcctggagaaagactttgagtttcgtcgtaacgccggcgagctc
aggggtcgcgagcgcaccacctcggaaatccccggtcgaggcattggcgagagcaatggc
cgcgtgatccagcactcgatcaatgactggaccgtcaacttggacatggacagcacggag
tattacgccggcgagaagatcaagcgggcgctggcccgctacccgttgcacgttatccgc
gccgacgtcgacccggaaaccaatcccttcggcctgcagtgggactgctactccgacacg
cctcaacgtatcgagcttgaggagccggccgcccccaccaagcgggagggaggtctatga

DBGET integrated database retrieval system