KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_62810Help
Entry
PA14_62810        CDS       T00401                                 

Gene name
secG
Definition
(GenBank) secretion protein SecG
  KO
K03075  preprotein translocase subunit SecG
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02024  Quorum sensing
pau03060  Protein export
pau03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PA14_62810 (secG)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA14_62810 (secG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PA14_62810 (secG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pau02044]
    PA14_62810 (secG)
Secretion system [BR:pau02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PA14_62810 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG
Motif
Other DBs
NCBI-ProteinID: ABJ14130
UniProt: A0A0H2ZHW2
Position
complement(5604283..5604672)
Genome map
AA seq 129 aa AA seqDB search
MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGIL
AAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSRPAESAG
DVPAAPEQK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaggtcgtaattgtcgtgcatctgctgatggcattgggtcttgttggcctg
atcctcgttcagcatggcaagggtgcggatgcaggggcttctttcggtgcaggtgcttcg
gcaactgttttcggaagccaaggttccgctacctttttgagtcggattactggtatactg
gcagcggtttttttcttgaccagccttggcttagcgtacttcgctaaagaaaagtctgat
gctctgcaacacatcggactgccggatccggcagttctggagcagaagcaagagaaagca
ccggccgctgacgatgtgccggttcttcaggagcagtccaggcctgcggaaagtgcaggc
gatgtaccggcggctcctgaacagaagtaa

DBGET integrated database retrieval system