KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_66950
Entry
PA14_66950        CDS       T00401                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00340  Histidine metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01230  Biosynthesis of amino acids
Module
pau_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PA14_66950 (hisE)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     PA14_66950 (hisE)
SSDB
Motif
Pfam: PRA-PH
Other DBs
NCBI-ProteinID: ABJ14450
UniProt: Q02EV0
Position
5977575..5977910
AA seq 111 aa
MSDTLTRLAAVLEERKNAAPDSSYVASLYHKGLNKILEKVGEESVEAIIAAKDAAASGDC
QDLIYETADLWFHSLVMLSALGQHPQAVLDELERRFGLSGHAEKAARQPSA
NT seq 336 nt   +upstreamnt  +downstreamnt
atgagtgacaccctgacccgtctggcggcggtgcttgaggagcgcaagaacgccgcgccc
gacagctcctacgtggccagcctgtaccacaagggcctgaacaagatcctggagaaggtc
ggcgaggagtcggtggaagccatcatcgccgccaaggatgccgcggccagcggcgactgc
caggacctgatctacgaaaccgccgacctctggttccactcgctggtgatgctctcggcc
ctcggccagcatccgcaagccgtgctggacgaactggagcgccgcttcggtctttccggc
cacgccgagaaagccgcccgccaaccatcggcctga

DBGET integrated database retrieval system