KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_67180
Entry
PA14_67180        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07126  uncharacterized protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PA14_67180
SSDB
Motif
Pfam: Sel1
Other DBs
NCBI-ProteinID: ABJ14468
UniProt: A0A0H2ZII1
Position
complement(5995985..5996854)
AA seq 289 aa
MAIGLWVVLCLAGVRVMANSKSFVCVNEKDHLPPLDSQTDAWYREAAALAKPDTLRPWGR
IVELYSKAVERGHWKAMHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLDVPQGFYDMGA
MIGNRAGVKNPATDGLTFLDKAASLGNPPALTELGKLYIYVAKKKDLGLAYTHCAASQGY
APASYELGAYYKIVEHNFPKALVYYQVSVSQGGKSAAFFLSRVFGSETPPASAMWYAPDE
KLREAYYSIYKKLEADPDLRFPNLIEDYPLPPHPTQGYDADRPDWKPER
NT seq 870 nt   +upstreamnt  +downstreamnt
atggctattggactttgggtcgtgctctgtcttgcaggcgtccgcgtgatggccaacagc
aaatcgtttgtctgcgttaatgaaaaagaccatctgccgccgttggattcgcaaaccgat
gcttggtaccgcgaagcagccgccttggccaagcccgatactctgcggccctggggccgt
atcgtcgagctttacagtaaggcagtggagcgcggccattggaaggccatgcataatttg
gcgaatctttatcgtacagggtggcccggaggagtagaaaaagatacgcagaaggcattg
gatctctatcaaaagatgatagatctggatgtgcctcaggggttctatgatatgggagca
atgattggaaatcgcgccggggttaaaaaccctgcaactgacggacttactttccttgat
aaggctgctagcctaggaaatccgccggcactaactgaactaggtaagctttatatatat
gtggccaaaaaaaaggatttggggttggcgtatactcactgtgctgctagtcagggttat
gcgccggctagttatgagctgggggcgtattacaagatagtagaacacaatttcccaaag
gcactggtttattatcaggtgtcagtctctcaggggggcaagagtgcggcttttttccta
tcacgagtcttcggaagtgagactccccctgcaagtgcaatgtggtacgcccccgacgaa
aagttgcgagaagcgtattattcaatctacaaaaagcttgaagctgaccccgacttacgt
ttccccaatctgatagaggactatcctctgcctcctcatcccacccagggctacgacgcg
gaccgcccagactggaagccggagcggtaa

DBGET integrated database retrieval system