KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_67220
Entry
PA14_67220        CDS       T00401                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB
Motif
Pfam: PLDc_2 PLDc ABC_tran_CTD
Other DBs
NCBI-ProteinID: ABJ14472
UniProt: A0A0H2ZIS7
Position
complement(5999498..6001735)
AA seq 745 aa
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEA
ARHSIDIITWGFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGA
GVGGSGGTWAGSGVASGSAVDNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSF
DPRGAAHARARIAELEAENAEIQRTLDSSEAQGYGGKRGSGGTRQDPWGQIFTRDWFKAV
RGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGNDDLGIGQLLVLTQ
FASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQV
QGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVT
NTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQ
ENNIERLERKIEALEEKGVTPEVEQRLGDLGAQEIPGLAKNTGEDDKPYQLAEAPGLKVV
VATLATSDPAPGSPPPARLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANI
NVRSMHGDSELGIAQPNPDLARAMREELWGAHVGRLAETTEKNFELWNQKMDDNWKAQVA
DEPFTSHLLRFWDVTTPYSQNLTVD
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgagcgacctgtacaaaccgcagaccctcaagctgtacgcgcaacaggccggcagcgtc
cggctgaccctcgactggttcgccaacaaggctttctacccgccgcgcgcgggtgtgcac
atcaagccgctgatcaatggccaggcggccttcgacgcggtgcatgcggcgatggaagcg
gcccggcacagcatcgacatcatcacctggggcttcgacccggccatgcgtttcaaacgc
cccgacggaccgcgaatcggcgaattgctgcagacgaagggccgcgaaggggtgcaggcg
cgggtgctggtctggagcaaccagctcgccaggctcaaggaaaacaccatccccggggcc
ggcgtcggcggttccggcggcacctgggcgggctcgggcgtcgccagcggcagcgcagtg
gacaacgaggtgctgcggctggagcagcggcgccagcataacctcaacctcatcgcgcgg
cagcaggaagccctggaacgctcggaacggctgcaccgcgaaggcaggctgccgagcttc
gacccgcggggcgccgcccacgcgcgggcgcgcatcgccgagctggaggcggagaacgcc
gagatccagcgcactctcgacagcagcgaggcccagggctacggcggcaagcgcggttcc
ggcggcacccgccaggatccctgggggcagatattcacccgcgactggttcaaggcggta
cgcggcggtgggttgcagaacgtcgagttccgtacccgcgacttcgagcagacggccagg
ccggtgatgaacggcgagcaagtgcgcctcgtcaacgggcggctgcaaagcctgatccac
ctgttgcgcgccgatggcaacgacgacctgggcatcggccagttgctggtactcacccag
ttcgccagccatcaccagaagatggtcctggtcgactatggcagcccgcaggccatcggc
ttcgtcatgggtcacaacatgcaccgcaactactgggacaccagcgcccacctgttcgac
gaccgcgccgccggtcgcgatcccgggttcgggccctggcaggatatctccatgcaggtc
cagggaccggtgctggccgacctcagccgcaacttcagcgaggcctgggacctcgagacg
ccgtggtacaagcgctggttctcgacgccatcgctgaccgccgagcgcgacgccttgccg
ctgccgaagatcgccacgcccgccagcaacagcgtcgcgcagatttgccggacccagccg
caggacgacgagcgctcgatcctggagcactatctcaaggccctgggcaatgccaccgac
tacgtctacatggaaaaccagtacttccgttatgccggcttcgccgagcgcctgcggaag
actgcgcaggtgcgcaaggcccggggcgtgcccggcgacctgtacctgttcgtcgtgacc
aacacccccgactccagcgacgcctcgaagaccacctacgacatgatgaaaggcctgggc
caggagcaactgatgccgcaggtacagcgcgacctggcgcatgacttgcgggaaaagcgg
gagcagttgaagcaggtcagggaaaacctacatcccgatccctatgtccggcgcggccag
gaaaacaacatcgaacggctggagcgcaagatcgaggcgctcgaagagaaaggtgtgacg
ccggaagtcgagcaacgcctcggcgatctcggcgcgcaggagattcccggactggcgaag
aacaccggcgaggacgacaagccctatcaactcgccgaagcacccggcctcaaggtggtc
gtcgccaccctggccaccagcgaccccgcccccggcagcccgccgccagcgcgcctgtcc
gccgaagccgaggccgccctcggggcaccaccgttgaaggcacgctacaagcacatctac
gtgcactccaagctgctgctggtggacgacctctataccctgctcagctcggccaatatc
aatgtccgcagcatgcatggcgacagcgagttggggattgcccagcccaatccggatttg
gcgagggcgatgcgggaggagttgtggggggcgcatgttgggaggttggccgaaacgacc
gaaaaaaacttcgaattgtggaatcagaagatggatgataactggaaggcccaggtggca
gatgagccttttacttcgcacttgctgcgcttctgggatgtcactacaccctatagtcaa
aatcttacggtggactga

DBGET integrated database retrieval system