KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_68700Help
Entry
PA14_68700        CDS       T00401                                 

Gene name
ompR
Definition
(GenBank) two-component response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PA14_68700 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pau02022]
    PA14_68700 (ompR)
Two-component system [BR:pau02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PA14_68700 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ TusA DUF43 MEDS Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ABJ14584
UniProt: A0A0H2ZIR0
Position
complement(6124863..6125606)
Genome map
AA seq 247 aa AA seqDB search
MSNPAALAEGEKILVVDDDARLRRLLERFLDEQGYRVRAVENTEQMDRLLSRELFQLVVL
DLMLPGEDGLTACRRLREQNNQVPIIMLTAKGDEGSRIQGLELGADDYLAKPFNPRELLA
RIKAVLRRQAPLVPGAPAGADEVVTFGDYQLFLATRELKKGDEVHMLTTGEFAVLKALVQ
HAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPDPSKPRYIQTVWGVGYVFVP
DGNARKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccctgccgccctggccgaaggtgaaaagatcctcgtcgtcgacgacgacgcc
cgcctgcgccgcctgctcgaacgtttcctcgacgagcagggctaccgcgtccgcgcggtg
gagaacaccgagcagatggatcgccttctatcccgcgaactgttccagctggttgtgctc
gatctgatgcttcccggcgaggacggcctcactgcctgccgccgcctgcgcgaacagaac
aaccaggtgccgatcatcatgctcaccgccaagggcgacgagggcagccgcatccagggc
ctggaactgggcgccgacgactacctggccaagccgttcaacccgcgcgaactgctggcg
cggatcaaggccgtgctgcgccgccaggcgccgctggtgcccggcgcgcctgccggtgcc
gacgaggtggtgaccttcggcgactaccagctgttcctcgccacccgcgaactgaagaag
ggcgacgaggtacacatgctgaccaccggcgagttcgccgtgctcaaggccctggtgcag
cacgcccgcgaaccgctgacccgggacaagctgatgaacctcgcccgtggccgcgagtgg
gatgccctggagcgttccatcgacgtgcagatctcgcgcctgcgccggctgatcgagccg
gacccgtccaagccgcgctatatccagacggtctggggtgtcggctacgtgttcgtgccg
gacggcaacgcgcgcaaggcctga

DBGET integrated database retrieval system