KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_68780Help
Entry
PA14_68780        CDS       T00401                                 

Definition
(GenBank) probable phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
KEGG Orthology (KO) [BR:pau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PA14_68780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABJ14591
UniProt: A0A0H2ZIR5
Position
complement(6133932..6135200)
Genome map
AA seq 422 aa AA seqDB search
MSLIADHGFAFLVLACLFGFFMAWGVGANDVANAMGTSVGSRALTIRQAILVAMVFEFCG
AYFAGGEVTETIRSGIVDPQYMTPDLLVFGMLSALLAAGVWLLLATIKGWPVSTTHSIVG
AIIGFASVGVSVHAVHWGAIGPIVASWVVTPVLSGLLAFALFRSVQWLVLHAEDPFRSAR
RYVPLYMFLAGFMVALMTVGKGLKHVGLELSGLQTLGLALLAGGLVMGLGIVLLLRIRPT
GGADPRGGFASVERVFAVLMIFTACSMAFAHGANDVANAIGPVAAVVAVVQAGGDLDLVS
RSPVPSWVLLLGAVGIVIGLATYGYRVIATIGREITELTPSRGFAAELATASTVVGASAI
GLPVSTTHTLVGAVLGIGMARGIGALNLRVIGSIFLSWVVTLPAGAVLAILFFLVLRALF
GA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatcgccgaccacggcttcgccttcctcgtactcgcctgcctgttcggtttc
ttcatggcctggggcgtcggcgccaacgacgtcgccaacgccatgggcacctcggtgggc
tcacgggcgctgaccatccgccaggcgatcctggtggcgatggtcttcgagttctgcggt
gcctacttcgccggcggcgaggtcaccgaaacgatcaggagcggcatcgtcgatccgcag
tacatgacccccgacctgctggtcttcggcatgctctcggccttgctggccgccggggtc
tggctgttgctggcgacgatcaagggctggccggtgtcgaccacccactccatcgtcggc
gcgatcatcggcttcgcctcggtcggtgtctcggtgcacgcggtgcactggggcgcgatc
ggcccgatcgtcgccagttgggtggtgacgccggtgctgtccgggctgctcgccttcgcc
ctgttcaggagcgtgcagtggctggtactgcatgccgaggacccgttccgcagcgcgcgc
cgctacgtgccgctgtacatgttcctggcgggcttcatggtcgcgctgatgaccgtcggc
aagggcctgaagcatgtcggcctggagctttccggcctccagacgctgggtctggcgttg
ctcgccggcggcctggtgatgggcctgggtatcgtcctgctgttgcgtatccgacccact
ggcggagccgatccgcgtggcggcttcgccagcgtcgagcgggtcttcgcggtgctgatg
atcttcaccgcctgctccatggctttcgcccatggtgccaacgacgtggccaacgccatc
ggcccggtggcggcggtcgtcgcggtggtccaggccggcggcgacctggatctggtgagc
cgttcgccggtgccgtcctgggtactgctgctgggcgcggtgggcatcgtcatcggcctg
gctacctatggctaccgggtgatcgccaccatcggccgggagatcaccgagctgaccccc
agccgcggcttcgccgccgagctggcgaccgcctccacggtggttggcgcctcggccatc
ggcctgccggtgtccactacccataccctggtcggcgcggtgctcggcatcggcatggcg
cgcggcatcggcgcgctcaacctgcgggtgatcggctcgatcttcctgtcctgggtagtg
accctgccggccggcgcggtgctggcgatcctgttcttcctggtcctgcgcgcgctgttc
ggtgcctga

DBGET integrated database retrieval system