KEGG   Pistricoccus aurantiacus: FGL86_10985Help
Entry
FGL86_10985       CDS       T06130                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paur  Pistricoccus aurantiacus
Pathway
paur00071  Fatty acid degradation
paur00072  Synthesis and degradation of ketone bodies
paur00280  Valine, leucine and isoleucine degradation
paur00310  Lysine degradation
paur00362  Benzoate degradation
paur00380  Tryptophan metabolism
paur00620  Pyruvate metabolism
paur00630  Glyoxylate and dicarboxylate metabolism
paur00640  Propanoate metabolism
paur00650  Butanoate metabolism
paur00900  Terpenoid backbone biosynthesis
paur01100  Metabolic pathways
paur01110  Biosynthesis of secondary metabolites
paur01120  Microbial metabolism in diverse environments
paur01130  Biosynthesis of antibiotics
paur01200  Carbon metabolism
paur01212  Fatty acid metabolism
paur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FGL86_10985
   00630 Glyoxylate and dicarboxylate metabolism
    FGL86_10985
   00640 Propanoate metabolism
    FGL86_10985
   00650 Butanoate metabolism
    FGL86_10985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FGL86_10985
   00072 Synthesis and degradation of ketone bodies
    FGL86_10985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FGL86_10985
   00310 Lysine degradation
    FGL86_10985
   00380 Tryptophan metabolism
    FGL86_10985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FGL86_10985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FGL86_10985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FGL86_10985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paur04147]
    FGL86_10985
Enzymes [BR:paur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FGL86_10985
Exosome [BR:paur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FGL86_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: QEA39549
UniProt: A0A5B8SQW8
Position
complement(2299407..2300594)
Genome map
AA seq 395 aa AA seqDB search
MSNDTEVVILSATRTPMGGLQGSLSSVPAPELAATAIRAAIERANIDANAIDEGILGCVL
PAGVKQGPARQAMRKAGIDDGIGATTINKLCGSGMKAAMLAHDIIRAGSSEVVLAGGMES
MSQAPHLLTKARGGYRLGHGELKDHMFFDGLEDAETGKLMGSFAQSVADERGYSRERMDD
FAIASLERAMAAHENGHLKGEMVPVAVQSRKGETVVEHDEQPFQARLDKIRDLRPAFAKD
GTITAANASSISDGASALILASRAAADKHGAKPVARVLGHSTHSQHPSEFTIAPVGAIDK
LLKKLDWRVGDVDLFEINEAFAVVTLLAMDGLDIPHDKVNVFGGACAQGHPIGSTGSRII
ATLINALKVKGGKRGIASLCIGGGEATAVAIELID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgataccgaagtggtcattttatccgcgacccgcacccccatgggtggcctg
caaggcagcctttcaagcgtgcccgcgccggaactggccgccaccgccattcgtgccgcc
atcgagcgagccaatatcgacgccaacgccatcgacgaaggcattctcggctgcgtgctg
cccgccggggtcaagcagggcccggcccgccaggccatgagaaaggccggcatcgatgac
ggcatcggcgccaccaccatcaacaagctgtgcggttccggtatgaaggccgccatgctg
gcccacgacatcattcgcgccggcagcagcgaagtggtgctggccgggggtatggaatcc
atgtcccaggcgccgcatctgctgaccaaggcccggggcggctatcgcctggggcatgga
gaattgaaggaccacatgttcttcgacggcctggaagacgcggaaaccggcaagctgatg
ggcagtttcgcccagtccgtcgccgatgagcgcggctattcccgagagcgcatggacgac
tttgccatcgcctccctggaacgggccatggcggctcacgagaacggtcatttgaaagga
gaaatggtaccggtggcggtgcagagccgtaagggcgaaaccgtcgtcgagcatgacgaa
cagcccttccaggcccgactcgacaagattcgcgacctgcgtccggccttcgccaaggac
ggcaccatcaccgccgccaacgccagttctatctccgacggcgcctcggcgctgatcctg
gccagccgcgccgccgcggacaagcacggtgccaagcccgttgcccgcgtgctcggccat
agcacccattcccagcaccccagcgaattcaccatcgccccggtgggcgctatcgacaag
ctgctgaaaaaactcgactggcgagtcggtgacgtggaccttttcgagatcaacgaggcc
tttgccgtggttaccctgctggccatggacgggctggacattccccacgacaaggtcaac
gtcttcggcggtgcctgcgcccagggccatcccatcggctccaccggctcgcggatcatc
gccaccttgatcaatgcgctaaaggtcaagggcggcaagcgcggcatcgcgagcctgtgc
atcggcggcggcgaagctacggcggtggccatcgagttgatcgactag

DBGET integrated database retrieval system