KEGG   Propionibacterium australiense: NCTC13651_02408
Entry
NCTC13651_02408   CDS       T06637                                 

Definition
(GenBank) methylaspartate mutase subunit S
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
paus  Propionibacterium australiense
Pathway
paus00472  D-Arginine and D-ornithine metabolism
paus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NCTC13651_02408
Enzymes [BR:paus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     NCTC13651_02408
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: VEH92267
UniProt: A0A383S5J3
Position
1:complement(2720302..2722527)
AA seq 741 aa
MTDRLDPNVKLDVDLIMQDLADYHPPRKGWTWRACPPEGVDMGGFHYRDMSEPLANSVPM
PAAKYFDGVDPQPSPVVTSEIASGHFEDDLRRMRMAAWNGADHIMVIRTTGQSHIDGLME
GTPEGVGGVPITRKQLRASRKACDLVEQEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGA
HQDPQYNVLYRNINMYRSFVDAAEAKKVMSGARIFQIDGAHNANATARHGWKVMPELMVQ
HGLNSMFSVLVGMPKDLIGLSTVPPSAPPAPKLWFDLPYAVALRDFFSEYRMRAQQNTRY
IESDLEEAIRTHVVDTMISMLTRADIQSTITPDEGRNLPWHYNSVRGVQTVKQTWAALDG
IKELLTLNREGPLGTMVRDIKERAIGFLTEMVHAGGYFAAIERGFFVDSALFPERNHDGI
ARDGSGGVAADTVIERDPDYLAPVSDHFGYNNVPEGVGCPSELIGGDTLTNPEKIVYIDE
LDPQDSVEQRLARTAAYRTGDLVRPEAEWAGDGVALLQLMIPENADIAREAALETAKRMG
LGDPEVVNLQVLQPAEGCFVEVKGHVGFDIDKTELYIPEKVELLPEDELRQVVSDNEINV
VAGTVGEDEHSVGLREILDIKHGGLEKYGVKYRYLGTSVPVEKMVDAAVESGADAILIST
VISHNDVHRTMMKKLSELATERGIRDTMVLIAGGTQVSREMAAETGLDATFGRGTKGIDV
LDAIVRTMRARGMVVAGKADG
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgactgaccggctcgatcccaacgtcaagctcgacgtcgacctcatcatgcaggaccta
gccgactatcacccgccccgcaagggctggacctggcgggcctgccctccggagggcgtc
gacatgggcggcttccactaccgtgacatgtccgagcccctcgccaacagcgttccgatg
ccggccgcgaagtacttcgacggcgtcgacccgcagccctcaccggtggtgacctcggag
atcgcctcggggcacttcgaggacgacctgcgccggatgcggatggccgcctggaacggc
gccgatcacatcatggtcatccgcaccaccgggcagtcccacatcgacggcctcatggag
ggcacccccgagggcgtcggcggcgtcccgatcacccgcaagcagctgcgggccagccgc
aaggcctgtgacctggtggagcaggaggtcggacgtccgatcaacttccacagctacgtc
tccggcgtggccggtcccgaggtcgccgtgctgttcgccgaggagggcgtcaacggggcc
caccaggacccccagtacaacgtgctctaccgcaacatcaacatgtaccgcagcttcgtc
gacgccgccgaggcgaagaaggtgatgagcggggcccgcatcttccagatcgacggcgcc
cacaacgccaatgcgacggcacggcacggctggaaggtgatgccggagttgatggtccag
cacggcctcaactcgatgttctccgttctcgtcggcatgcccaaggacctcatcgggctg
tccacggtgccgccgagcgccccgcccgccccgaagctgtggttcgacctgccctacgcg
gtcgccctgcgggacttcttctccgagtaccggatgcgcgcccagcagaatacccggtac
atcgagtccgacctcgaagaggcgatccgcacccacgtggtggacacgatgatctccatg
ctcaccagggccgacatccagtcgaccatcacccccgacgagggccgcaatctgccctgg
cactacaactcggtgcgcggagtgcagacggtcaagcagacctgggcggcgctggacggc
atcaaggaactcctcaccctcaaccgggagggcccgctcgggacgatggtgcgtgacatc
aaggaacgagccatcggcttcctcaccgagatggtccacgccggcggctacttcgccgcc
atcgagaggggcttcttcgtcgactcggcgctgttccccgagcgcaaccacgacgggatc
gcccgggacggctctggtggcgtcgccgccgacaccgtcatcgaacgcgacccggactac
ctggccccggtcagcgaccacttcggctataacaacgtgcccgagggcgtcggctgcccc
agcgaactgatcggcggggacaccctgaccaatccggagaagatcgtctacatcgacgaa
ctcgacccgcaggacagcgtcgagcagcggctcgcccgcaccgccgcctaccgcaccggc
gacctggtgcgcccggaggccgagtgggccggcgatggcgtggccctgctccagctgatg
atccccgagaacgccgacatcgcccgcgaggcggccctggagaccgccaagcggatgggc
ctgggggacccggaggtggtcaacctgcaggtcctgcagcccgcggagggctgcttcgtc
gaggtgaagggtcacgtcggtttcgacatcgacaagaccgagctgtacatccccgagaag
gtcgagctgctccccgaggacgagctgcgtcaggtcgtcagcgacaacgagatcaacgtc
gtcgccggcaccgtcggcgaggacgagcacagcgtcgggctgcgcgagatcctcgacatc
aagcacggcggcctggagaagtacggtgtcaagtaccgctacctgggcacctcggtgccg
gtcgagaagatggtggacgcggccgtcgagagcggcgccgacgccatcttgatctccacg
gtcatcagccacaacgacgtgcaccgcacgatgatgaagaagctgtccgagctggccacc
gagcggggcatccgcgacacgatggtgctcatcgccggcggcacccaggtgagccgcgag
atggccgccgagaccgggctggacgccactttcggccgcggcaccaagggcatcgacgtg
ctcgacgccatcgtccgcaccatgcgggcccgcggcatggtcgtagcagggaaagccgac
ggatga

DBGET integrated database retrieval system