KEGG   Propionibacterium australiense: NCTC13651_02409
Entry
NCTC13651_02409   CDS       T06637                                 

Definition
(GenBank) Uncharacterised protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
paus  Propionibacterium australiense
Pathway
paus00472  D-Arginine and D-ornithine metabolism
paus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NCTC13651_02409
Enzymes [BR:paus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     NCTC13651_02409
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: VEH92269
UniProt: A0A383S4S2
Position
1:complement(2722520..2722903)
AA seq 127 aa
MTEITEEQEREARFDALRQELAAMDDDALKARFWELCEEVMTPIVELARTHTSPSIERSV
LLRMGVDSVTTHGVVENVLQAGLLGKGAGHAVLRLSQRDELPIPEAAARIATDAGVLNGL
FEGADND
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaccgagatcaccgaggaacaggagcgggaggcccgcttcgatgccctgcgccaggaa
ctggcggcaatggacgacgacgccctcaaggccaggttctgggaactgtgcgaggaggtg
atgacgccgatcgtcgagctcgcccggacccacacctcgccctcgatcgaacgctccgtg
ctcctgcgcatgggggtcgactcggtgaccacccacggagtcgtcgagaacgtcctgcag
gccggcctgctcggcaagggggcgggtcacgcggtgctccgcctgtcccagcgcgacgag
ctgccgatacccgaggccgccgcgagaatcgccaccgacgccggcgtgctgaacggtctc
ttcgaaggagcggacaatgactga

DBGET integrated database retrieval system