KEGG   Pseudonocardia autotrophica: Pdca_38540Help
Entry
Pdca_38540        CDS       T06156                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
paut  Pseudonocardia autotrophica
Pathway
paut00360  Phenylalanine metabolism
paut00362  Benzoate degradation
paut00621  Dioxin degradation
paut00622  Xylene degradation
paut01100  Metabolic pathways
paut01120  Microbial metabolism in diverse environments
paut01220  Degradation of aromatic compounds
Module
paut_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paut00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Pdca_38540 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pdca_38540 (mhpE)
   00622 Xylene degradation
    Pdca_38540 (mhpE)
   00621 Dioxin degradation
    Pdca_38540 (mhpE)
Enzymes [BR:paut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Pdca_38540 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm ThiG
Motif
Other DBs
NCBI-ProteinID: BBG02645
Position
4080015..4081049
Genome map
AA seq 344 aa AA seqDB search
MSRPVLEHDIRIIDTSLRDGSHAMAHRFTETQVRDTVRALDRAGLEVIEVSHGDGIGGSS
FNYGFSRTDEMTLIAAAREEAARAKIAVLLVPGIGTADDLRRARDAGADMVRIATHCTEA
DVSPQHFGVARELGMETAGFLMMAHRTSPENLARQARIMVDAGCQAPYVTDSAGALLMHE
ARARFEALLAEVGDDAWVGYHGHQNLSLGVANSVIAQEVGVRYIDGSLCALGAGSGNSPT
EVLAAVFDRLGVGTGLDAGAVIDAAEDVVRPFLPRWPKMDRNAIVQGWAGVYSSFLLHAE
RAGDRYKVAPHEILRRCGELGYVGGQEDMIIDVAMELAGEHAHA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcccgtcctcgagcacgacatccgcatcatcgacacctcgctgcgcgacggc
agccacgcgatggcccaccggttcaccgagacccaggtacgcgacaccgtccgcgccctg
gaccgggccggactggaggtcatcgaggtctcgcacggcgacgggatcggcgggtcgtcg
ttcaactacggcttctcccgcaccgacgagatgacgctgatcgccgccgcccgcgaggaa
gcggcccgggcgaagatcgcggtgctgctggtaccggggatcggcaccgccgacgacctg
cgccgcgcccgcgacgccggggcggacatggtccggatcgcgacccactgcaccgaggcc
gacgtgtccccgcagcacttcggcgtcgcccgggagctcggcatggagaccgccgggttc
ctgatgatggcccaccggacctcaccggagaacctcgcgcgccaggcgcggatcatggtg
gacgccggctgccaggccccctacgtcaccgactcggccggggccctgctgatgcacgag
gcccgcgcccggttcgaggcgctgctggccgaggtcggtgacgacgcctgggtcggctat
cacggacaccagaacctcagcctcggcgtcgcgaactcggtgatcgcccaggaggtcggc
gtccgctacatcgacgggtcactgtgcgccctcggcgccggatcgggcaactcccccacc
gaggtgctggccgcggtgttcgaccggctcggtgtcgggaccggcctcgacgccggcgcg
gtgatcgacgccgccgaggacgtcgtccgcccgttcctcccgcggtggccgaagatggac
cgcaacgcgatcgtccagggctgggcgggtgtctactcgtcgttcctgctgcacgcggag
cgagccggcgaccgctacaaggtcgccccgcacgagatcctgcgccgctgcggcgagctc
ggctacgtcggcggccaggaagatatgatcatcgacgtcgcgatggaactcgccggggag
cacgcacatgcctga

DBGET integrated database retrieval system