KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_01530Help
Entry
TIA2EST22_01530   CDS       T01654                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00860  Porphyrin and chlorophyll metabolism
pav01100  Metabolic pathways
pav01110  Biosynthesis of secondary metabolites
pav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIA2EST22_01530
Enzymes [BR:pav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TIA2EST22_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEW80638
Position
complement(347882..348607)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAERLTAPDLWQA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVDFVPENHSGAGLVAEWP
GGVASILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKLPEVIAQSWPSVGVVVVT
ASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcctgccgatctcgtcaagcccccagttgttgttccccgtgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggatgcggagaggcttactgcccctgacctgtggcaggcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagctgcggtcggcgccgctacctctgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgagaatcacagcggcgctggtctggtcgccgagtggcca
ggtggagtcgccagtatcctcctaccagcgtcccagttaaccgccgataccgtaccgctg
ggactgacgaaggtcggctgcacggtaaaccgattggagatctataccaccgctgccgtc
gagaaactgcctgaggtcatcgcccagtcgtggccgtctgtcggggtcgtcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtagagccgctgggatggcgtcgtcag
aagctcgtcgccctcggtaagcccactgcaagaacactcgaagtactcggtcacccagcg
catgcggtggcctcctcccccactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system