KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_01895Help
Entry
TIA2EST22_01895   CDS       T01654                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pav00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TIA2EST22_01895 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pav01007]
    TIA2EST22_01895 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pav03016]
    TIA2EST22_01895 (cysS)
Enzymes [BR:pav01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     TIA2EST22_01895 (cysS)
Amino acid related enzymes [BR:pav01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TIA2EST22_01895 (cysS)
Transfer RNA biogenesis [BR:pav03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TIA2EST22_01895 (cysS)
 Prokaryotic type
    TIA2EST22_01895 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEW80711
Position
complement(421772..423202)
Genome map
AA seq 476 aa AA seqDB search
MTFKLYNTATHGIETFKPLREGQVSIYHCGMTVQSSPHLGHIRKEVVFDVLRRWLECSGY
RVTVVANVTDIDDKILAKSAAAGTPWWAHAYHYENELHAAYKALGCRPPTYEPRATGHIP
EMIELVKTLIEKGHAYPAPDGSGDVYFDVRSWPRYGELSGMRVDEMSPAEDSDPRGKRDP
RDFALWKGHKEDEPETASWVSPWGRGRPGWHLECSAMSGKYLGEAFDIHGGGIDLRFPHH
ENELAQSAAAGRPFAHYWMHNAWVTMSGGKMSKSLGNTAQVSEVTKTYSPRAVRYFLLAP
HYRSMIEFSPSDEGTKGSLDEATKAIERIDSFLDRASNLVGEQVTASHELSEAFVIAMDD
DLGTPQAVAALFSQITEGNKSVSIGDAEATRHHLSQVKAMLAVFGLDPQAPEWADTATGD
ARLEPVVDGLVQAMLDQRAEARARKDWTTADAIRDTLTNLGLTIEDTPTGAHWSLS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtttaagctctacaacaccgctacccatggcatcgagacctttaagccccttcgt
gagggccaggtgtcgatttaccactgtggaatgacggtgcagtccagtccacatctgggc
catatccgcaaggaggtcgtcttcgacgtcctgcggcgctggttggagtgttctggctac
cgggtgaccgttgtcgccaacgtcaccgatatcgacgacaagatcctcgctaagtccgct
gctgccggcaccccgtggtgggcccatgcgtaccactacgaaaatgagcttcatgcggcg
tataaagcattgggatgccgtccgccgacctatgagcctcgagccaccggtcacatcccg
gagatgatcgagttggtgaagaccctcatcgaaaaaggtcacgcttatcctgcccccgat
ggctccggtgacgtctacttcgatgttcgatcctggccgcgctacggggaattgtccggg
atgcgtgtcgacgaaatgagcccggccgaggattcagacccgcgtggtaaacgcgaccca
cgtgactttgcactgtggaagggccataaagaggacgagcccgaaacagcgtcgtgggtg
tctccgtggggacgcggtcgacctgggtggcacctggagtgctcggcgatgtccgggaag
tatttgggcgaggccttcgatattcacggtggcggtatcgacttgcggttccctcaccat
gaaaacgagttggctcagtcagcagcagctgggcgtcctttcgcccactattggatgcac
aacgcttgggtgacgatgtctggggggaagatgagcaagtccctgggtaataccgcccaa
gtgtctgaggtcaccaagacctacagcccgcgagccgtcaggtacttcctgctggccccg
cattatcgctccatgatcgagttcagcccctccgacgagggcaccaagggctccctggat
gaggccaccaaagccatcgagcgcatcgattccttcctggaccgcgccagcaacctcgtt
ggcgagcaggtgacggcttcgcatgaattgtcggaggcgttcgtcattgcgatggacgat
gaccttggtactccccaggcggtggcggccctgttcagccaaatcaccgaaggtaataag
tccgtgtcgatcggcgatgctgaggccacccgtcatcacctgtcccaggttaaagccatg
ctcgcggtattcggactcgatcctcaggcccccgagtgggccgacaccgcaacaggcgac
gcccgtctagaaccggtcgttgacggcttggtgcaggccatgctggaccagcgtgccgag
gctcgcgcccgcaaagactggaccacggctgacgccatccgcgacaccctgacaaacctt
ggattgacgatcgaagacacccccaccggcgcccattggtcgctgagctga

DBGET integrated database retrieval system