KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_06825Help
Entry
TIA2EST22_06825   CDS       T01654                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00240  Pyrimidine metabolism
pav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pav00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TIA2EST22_06825
Enzymes [BR:pav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     TIA2EST22_06825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF2254
Motif
Other DBs
NCBI-ProteinID: AEW81677
Position
1465203..1466492
Genome map
AA seq 429 aa AA seqDB search
MTSTYSVVDLIRAKREGQTLNSDQIAWLIRAYTDDIVADEQMSAMAMAVYFQGLDDAELS
AWTTAMIKSGERMSFAGLSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGH
TGGTLDKMEAIPGWRADLSHDEMVAQLEKVGAVICAAGPGLAPADKKLYALRDVTGTVES
IPLIASSIMSKKIAEGTDSLVLDVKTGSGAFMKTDKDARELASRLVELGEAAGVRTTALL
THMDVPLGYACGNGIEVAESLEVLAGGGPADVVELTVALARHMVKVAGLDGIDPADVLAS
GQAMDVWRNMVRAQGGDPDAPLPMAHHTQDIVATEAGVITGIDAMSVGLAAWRLGAGRAR
KEDPVQAAAGIMLRVRPGDRVVTGQPLATLLTDTPDSIARAEDAMTNAFTVGQTFQPQDI
VIDTVVAQS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcacctattccgtcgtcgaccttatccgcgctaagcgcgaaggccagactctc
aactccgaccaaatcgcatggcttatccgcgcctacaccgacgacatcgtcgccgacgag
cagatgtctgccatggcgatggcggtgtacttccaggggctcgacgacgctgagctgtca
gcctggacgacggccatgatcaagtcgggcgagcggatgtccttcgctgggctgtcccgc
cccactgtcgacaagcactccactggcggcgtgggcgacaaaattaccttgccgctggct
cccctggtggccgcgtgcggtgctgccgtcccacagctgtctgggcgtggcctgggccac
accggaggcaccctcgacaagatggaggccattcccggatggcgggcggatctctctcat
gacgagatggtcgcccagctcgagaaagtcggcgccgtcatctgcgcagcgggcccggga
ctagcccctgctgacaagaagctctacgccctgcgcgacgttaccggcaccgtcgagtcc
atcccgctgatcgcttcgtccatcatgagcaagaagatcgcagagggcaccgacagcctc
gtcctcgatgtcaagaccggctcgggtgccttcatgaagacagataaggacgcccgcgaa
ctcgccagccgtctcgtcgagctaggtgaagccgccggggtgcgtaccaccgccctactg
acccacatggacgtcccactgggttacgcctgcggtaacggcatcgaggttgccgaatcc
ctcgaggtgttagccggcggaggtcctgccgacgtcgtcgagctcaccgtcgccctggcc
cgtcacatggtgaaggtggctggattggacggcatcgacccggccgatgtactcgccagt
ggccaggcaatggatgtctggcgcaacatggttcgtgcccagggcggcgaccctgacgct
ccactaccgatggcccaccacacccaggacatcgtcgccaccgaggctggcgtcatcacc
gggattgatgccatgtccgttggcctagctgcctggcgtttgggtgccggacgcgcccgc
aaagaggatccggtgcaagctgcggctggcatcatgttaagagttcgccccggcgaccgc
gttgtcacaggccagccattggccaccctgctcaccgacacccccgactccattgcgcgg
gccgaggatgccatgaccaacgcgttcaccgtcgggcaaaccttccagccgcaagacatt
gtcatcgacaccgtcgtagcccagtcgtga

DBGET integrated database retrieval system