KEGG   Cutibacterium acnes TypeIA2 P.acn17: TIA2EST22_11180
Entry
TIA2EST22_11180   CDS       T01654                                 

Definition
(GenBank) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
pav  Cutibacterium acnes TypeIA2 P.acn17
Pathway
pav00472  D-Arginine and D-ornithine metabolism
pav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    TIA2EST22_11180
Enzymes [BR:pav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     TIA2EST22_11180
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AEW82520
Position
2409041..2411359
AA seq 772 aa
MTIQDTCLHHKHTREREQLGPNNKSAVTPSEPVEPRTEQDLPGPNTKLNVEEILTDLEHY
HPRRKGWTWRNVPEEGIDMGDFHYRNMSTPLKQSMPLPAAEYFENIDPQPAPVVTSEIAS
GHFEDDLRRMRMAAWHGADHIMVIRTTGQSHIDGLLEGTPEGIGGVPITRKQLRASRKAC
DLIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAG
EAKKAMAGAQIFQIDGAHNANATARHGWKVMPELMVQHGLNCMYSVLVGMPKDLIGLSTV
PPSAPPAPKLWYDLPYAVALRDLFSEYKMRAQQNTRYIESDLAEAIRTHTIDTLISMLTS
ADIQSTITPDEGRNLPWHHNSVRGVQTVKQTWAALDGIKEMVTINREGPLGHMVRDLKER
AIGFLTEMLHVGGYFVAVEDGFFVDSAEFPERNHDGIARDGQGGIAEGTVVERDPDYLAP
VCDHFGNNNLPEGLNKPCDLIDGCTLCKPEKIVYIDELDPNDSAATRLACTRPFRDGTAL
RPEAEWAGDGVVLVQMNIPGSEDIAREAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVK
GQATHVDVNPSKLTIPEKIELLPADELRQFVTDHELSVVAGTVGEDEHSVGLREILDIKH
GGIEKYGVQYRYLGTSVPVEKMVDAAIESGADAILISTIISHNDIHRTMMRKLADLATEK
GIRDKVVLVAGGTQVNREMAAETGLDATFGRGTKGIDVLDAIVRTMRTRAEA
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgactatccaagacacgtgcctgcaccacaagcacacccgcgaacgcgagcagctcggc
ccgaataacaagtccgccgtgacgccttcagagcccgtcgagccccgcaccgagcaggac
ctcccaggcccgaataccaaactcaatgtcgaggagatcctcaccgaccttgagcactac
cacccccgtcgcaagggatggacctggcggaacgtgccggaagagggaatcgacatgggc
gacttccactaccggaacatgtccaccccgttgaagcagagcatgcctctgcccgccgca
gagtacttcgagaacattgatccccagccggcacccgtcgtcacctccgagatcgcctcc
gggcacttcgaggacgacctgcgccgtatgaggatggcggcctggcacggagctgaccac
atcatggtcatccgcaccaccggacagagccacatcgacggactactagagggcaccccg
gaaggtatcggcggcgttccgatcacccgtaaacagctgcgcgctagccgcaaggcctgc
gacctcatcgaggacgaggtagggcgccccatcaacttccactcctacgtgtccggagtc
gccggccctgaggtggccgtcctcttcgccgaagagggggttaacggtgctcatcaagac
ccgcaatacaacctgctgtaccgcaacatcaacgcctaccgcagctatgttgacgccggt
gaagccaagaaggcgatggcgggagctcagatcttccaaatcgacggtgcacacaacgcc
aacgccactgcccggcacggttggaaggtcatgcccgagctcatggtccagcacggcctc
aactgcatgtactcagtgctggtaggaatgccgaaggacctcatcggcctgtcgacggtt
ccgcccagcgctcccccggcgccgaaactctggtacgacctgccgtacgcagtagccctg
cgcgatctgttcagcgagtacaaaatgcgcgcccagcagaacacccggtacatcgagtcc
gacctcgccgaggccatccgcacccacaccatcgacactctcatctcaatgctgaccagc
gcggacatccagagcaccatcacccctgatgaaggccgcaacctgccctggcaccacaac
tctgtccgcggcgtccagacggtcaaacagacctgggccgctctcgatggcatcaaggag
atggtgaccatcaaccgcgaggggccactcggccacatggtgcgtgacctcaaggagcgg
gcgatcggtttcctcaccgagatgctgcacgtgggtggctacttcgtcgccgttgaggac
ggattcttcgtcgactcggcagaattcccggaacgcaaccacgacggcatcgcccgtgac
ggccaaggcggaatcgccgagggaaccgtcgtcgagcgtgaccccgactacctcgcccca
gtctgcgaccatttcggcaacaacaacctgcccgagggccttaacaagccgtgcgacctc
atcgacggctgcaccttgtgcaaacccgagaaaatcgtctacatcgatgagctcgacccc
aacgactcggccgcgacccgcctggcctgcacccgcccgttccgcgacggcacagcgcta
cggcccgaggctgaatgggccggtgacggtgtcgtcctggtacagatgaacatccccggc
tccgaggacatcgcccgcgaggcggccgtcgagatggcacgcaagatgggcatcaccgac
ccacaggtatgcaacctgcaagtgctgcaccccgccgaaggatgcttcgttgaggtcaaa
ggccaggcgacccacgtcgacgtcaacccatccaagctgacgatccccgagaagatcgaa
ctgctacccgccgacgaactacgccaattcgtcaccgaccacgagttgtcggtggtggcc
ggcactgtcggtgaggacgagcacagcgtcgggctgcgcgagatcctcgacatcaagcac
ggtggcatcgagaagtacggggtgcaatatcgctaccttggcacatcggtgccggtggaa
aagatggtcgatgccgctatcgagagtggcgccgacgccatcctcatctccacgatcatc
agtcacaacgacatccatcgcaccatgatgcggaagttggctgatctggccaccgagaag
ggcatccgcgacaaggtcgttctcgtcgccggcggcacccaggtgaaccgggagatggca
gcagagaccggcttggacgccaccttcgggcgcggcaccaagggcatcgacgtccttgac
gccatcgtgcgcactatgcggacccgcgcggaagcctga

DBGET integrated database retrieval system