KEGG   Prunus avium (sweet cherry): 110744778Help
Entry
110744778         CDS       T05161                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi03040  Spliceosome
pavi04141  Protein processing in endoplasmic reticulum
pavi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110744778
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110744778
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110744778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pavi01009]
    110744778
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pavi03041]
    110744778
   03009 Ribosome biogenesis [BR:pavi03009]
    110744778
   03110 Chaperones and folding catalysts [BR:pavi03110]
    110744778
   04131 Membrane trafficking [BR:pavi04131]
    110744778
   03051 Proteasome [BR:pavi03051]
    110744778
   03029 Mitochondrial biogenesis [BR:pavi03029]
    110744778
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pavi04147]
    110744778
Protein phosphatases and associated proteins [BR:pavi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110744778
Spliceosome [BR:pavi03041]
 Complex B
  Other components
   Prp19 complex
    110744778
 Complex C
   Prp19-CDC5 complex
    110744778
Ribosome biogenesis [BR:pavi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110744778
Chaperones and folding catalysts [BR:pavi03110]
 Heat shock proteins
  HSP70 / DNAK
   110744778
Membrane trafficking [BR:pavi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110744778
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110744778
Proteasome [BR:pavi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110744778
Mitochondrial biogenesis [BR:pavi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110744778
Exosome [BR:pavi04147]
 Exosomal proteins
  Proteins found in most exosomes
   110744778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR FGGY_C
Motif
Other DBs
NCBI-GeneID: 110744778
NCBI-ProteinID: XP_021800483
Position
Unknown
AA seq 405 aa AA seqDB search
CSAEDISSMVLKKMRKISETYLGSTVKNAVITVPAYFNYSQRRATKEAGISAGLNVLRIM
NEPSAAAIAYGLNKKAGWRSPRNVMIFDLGGGTLDVSLLTMSTSGDFQVKATAGDIHLGG
QDFDSRLVKYCVEEFKRKHKLDVSGNKRAFRRLKNECEKAKKRLSFESDFEVEIDCLWEN
TDFTITFTRAIFEQLNRDLFIKCMEPVKKCLTDANMDISSVDDVVLVGGSTRIPMVQQLL
QEFFKGKELCKGVNPDEAVAYGAAVQAATLTRNGKGEFIQDYTLKDVTPLAIGLEFADNK
KFVKLIPRNSLIPVKKKIKCPIKDNQVSVDFRMYEGESSSPANLNFLGECSLRYIPPAPK
LVHNFDVFFEIDPDGILSVFTEDKSSGQKNEIIINRDRPKNFEGN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
tgttctgctgaagatatctcatccatggttctgaaaaagatgaggaagatttccgagacc
tacttgggctcaactgtgaaaaatgcggttatcactgtccctgcttacttcaattactca
caacgccgagctacaaaagaagcaggcatctctgctggcttaaatgtgttgcgtattatg
aacgaaccaagtgctgctgccattgcttatggccttaacaaaaaggccggttggaggagc
ccacgaaatgtgatgatatttgatttgggtggtggcactttagatgtgtcattgcttacc
atgagcacttctggtgactttcaagtaaaggcaacggctggagacattcaccttggtggc
caagacttcgatagcagattggtgaaatactgtgttgaggaattcaagaggaagcacaaa
ttggatgtaagtggaaataaaagagcttttaggaggttaaaaaatgaatgtgagaaggca
aagaagagactctcatttgagtctgacttcgaggttgaaattgactgtttgtgggagaat
actgatttcaccataacttttactcgtgccatatttgaacaactaaacagagatttattt
atcaagtgtatggagcctgtgaagaagtgcttaacggatgctaacatggacataagcagt
gtcgacgacgttgttcttgttggtggctctactagaattcccatggttcaacagctatta
caggagtttttcaaggggaaggagctgtgcaagggcgttaatccggatgaggcagtggca
tatggtgcagcggttcaagccgcaaccttgactaggaatggaaaaggggagtttattcag
gactacactctcaaggacgtcactcctcttgcaattggtttggagtttgcagataataag
aagttcgtaaagttgattccaagaaactcactaattcccgtcaagaagaaaataaaatgt
cctatcaaggataaccaagtttcggtcgacttccgcatgtacgagggtgagagtagctcg
ccagccaatctcaactttttgggtgaatgcagcctccgttacattcctccagctcccaaa
cttgttcataatttcgatgttttcttcgaaattgatcccgatggaatcttgagtgtcttc
actgaagataagtcctctggccagaagaatgagatcataatcaaccgtgacagaccgaag
aactttgaggggaactga

DBGET integrated database retrieval system