KEGG   Prunus avium (sweet cherry): 110745192Help
Entry
110745192         CDS       T05161                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 2
Organism
pavi  Prunus avium (sweet cherry)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 110745192
NCBI-ProteinID: XP_021800960
Position
Unknown
AA seq 237 aa AA seqDB search
RLLGCSCAGPESLLVYEYLPNRSLDRFIFDQESGKTLNWDKRYEIIVGTAEGLVHLHDNS
KTRIIHRDIKASNILLDSRLRAKIADFGLARSFEEDKSHISTAIAGTLGYMAPEYLAHGQ
LTEKVDVYSFGVLILEIVTGRQNNRSKSAEYSDSIVTITWKHFQAGATEELYDSNLMLQN
CNDDVKDEILRVVQIGLLCTQESPSLRPKMSKALQMLTKKEQPLPWHSRICRYTKNG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
aggctgttgggttgtagttgcgcaggacccgaaagccttctcgtctatgaatacctgccc
aacaggagtcttgaccgcttcatcttcgatcaagaaagtggtaaaacactaaactgggac
aagagatatgagatcattgttgggacagcagaaggcttagtccaccttcacgacaactcg
aaaacaaggatcattcacagagacataaaagccagcaacatccttttggattcaaggcta
cgagctaagattgcagatttcgggttggctaggtctttcgaggaagataagagccacatc
agcacagccattgcaggaacattgggatacatggctccagagtacctagcccatggccag
ctgacagagaaggtagatgtctacagttttggagtgcttatattggagatagtcactgga
aggcagaacaacaggagcaaatctgcagagtactcagacagcatagtcacaattacttgg
aagcactttcaagcaggggctacagaggaactatacgactcaaatttaatgctgcagaat
tgcaatgacgatgttaaggatgagatactgagagtggtgcaaataggacttctatgcacc
caagagagtccctctttacgacccaaaatgtcaaaggcactgcagatgctaacaaagaag
gagcagccccttccttggcattcgaggatttgtagatataccaagaatggttga

DBGET integrated database retrieval system