KEGG   Prunus avium (sweet cherry): 110746240Help
Entry
110746240         CDS       T05161                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110746240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pavi03041]
    110746240
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110746240
Spliceosome [BR:pavi03041]
 Complex C
  Other components
   Step II factors
    110746240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind
Motif
Other DBs
NCBI-GeneID: 110746240
NCBI-ProteinID: XP_021802140
Position
Unknown
AA seq 302 aa AA seqDB search
MSPTSIPEIQRINLGFTTLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEG
LLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQK
RAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKL
DVVSAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRPLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKMSKRKRQERIEPLYDRYHEPNSWRLSKR
RA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctacttcaattccagaaatccagaggataaatcttgggtttactacgcttacg
atgaaagccatggggataaatgatctcttgtcttttgattttatggatcctccttcaccc
caagcactcatttctgccatggaacaattgtacagtttaggagcactggatgaggagggg
ctgctcaccaaattgggtaggaaaatggctgagtttcctctggatccacccttgtctaag
atgctattggccagtgtggaccttggatgcagtgatgagatcttgaccatcattgcaatg
attcagactggtaatattttttacaggcctagggaaaaacaagcccaggcagatcagaag
agagccaagtttttccagccagagggagatcatctgactttacttgcagtctatgaggca
tggaaagctaagaatttttcagggccatggtgttttgagaactttgttcaatctcgatcc
ttgaggagggcacaggatgtcagaaaacagcttctcagcatcatggacaaatataaacta
gatgttgtgagtgctggaaagaattttacaaagatcaggaaggcaattacggcagggttt
ttcttccacggtgctagaaaggacccgcaggagggttatagaaccctagtggagaaccaa
ccagtttatatacacccaagcagcgccctcttccagagaccactnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnncaccaagatgagcaagcgcaagcgtcaagaa
cgtattgaaccgctatatgatagataccatgaacctaactcttggcgtcttagtaagcga
cgtgcttga

DBGET integrated database retrieval system