KEGG   Prunus avium (sweet cherry): 110746349Help
Entry
110746349         CDS       T05161                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pavi  Prunus avium (sweet cherry)
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pavi04131]
    110746349
Membrane trafficking [BR:pavi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110746349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 110746349
NCBI-ProteinID: XP_021802255
Position
Unknown
AA seq 1832 aa AA seqDB search
MLNLRPRRDSTPYTTKWQNKFEENLEQWPHLKELVQCYTTDWVKDENKYGHYESVGPSSF
QNQIYEGPDTDIETEMHLSSARRTKVEDTTDDDVPSTSGRQFMDATVSDSVHSNDPKHFG
QSPLPAYEPAFDWENERSMIFGQRVPETPISHGLKISVKVLSLSFQAGLAEPFYGTICLY
NRERREKLSEDFYFRHAPTEKKDISFEPRGIFYLDAPSSSVCLLIQLEKHATEEGGVTPS
VYSRKEPVHLTEKEKQKLQVWSQIMPYRESFAWAVVSLFDNSIGAASGGSASPSSPLAAS
ISGSSSHEGVFEPSAKVTLDGKLGYSSRSSVVVEISNLNKVKECYTEDSLQDPKRKIHKP
VKGVLRLEIEKHQNDHVDMENISESGSVTNDSIDDRITDSTFGKLPSNGLDGPQGSSSKW
NSFDAKEISGNGSNAHGNSVPGSDDFQAFDFRTTTRNEPFLQLFHCLYVYPMTVSLSRKR
NLFIRVELREDDNDIRRQPLEAMYPREPSASLQKWAHTQLTVGARVACYHDEIKLSLPAT
WTPTHHLLFTFFHVDLQTKLEAPKPIVIGYAALPLSTHAQLRSEISLPIMRELVPHYLQD
MARERLDYLEDGKNIFRLRLRLCSSLYPINERIRDFFLEYDRHTLRTSAPWGSELLEAIN
SLKNVDSIALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNIVTRVQQESVDDAERNHF
LVNYVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLELIVK
SMALEKMRLFYHNLPLGEDIPPMQLKEGVFRCIMQLYDCLLTEVHERCKKGLSLAKRLNS
SLAFFCYDLLSIIEPRQVFELVSLYLDKFSGVCQLVLHDCKLTFLQIICDHDLFVEMPGR
DPSDRNYLSSVLIQELFLTWDHDDLSLRAKAARILVVLLCKHEFDARYQKPEDKLYIAQL
YFPLIGQILDEMPVFYNLNAVEKREVLVAILQIVRNLDDASLVKAWQQSIARTRLFFKLM
EECLVLFEHRKPADGMLMGSSSRSPVGDGPASPKYSDRLSPAINNYLSEASRQEVRPQGT
PENGYSWQRVNSQLSSPSQPYSLREALAQAQSSRIGASAQALRESLHPILRQKLELWEEN
LSASVSLQVLEITEKFSTMAASHSIATDYGKFDCVTAIFMSFFSRNQPLSFWRSLLPVFN
SVFNLHGANLMARENDRFLKQVTFHLLRLAVFRNDNIRKRAVMGLQMLIRSSFYYFMQTA
RLRVMLIITLSELMSDVQVTQMKSDGTLEESGEARRLRQSLEEVADASKSPSLLRECGLP
ESALLDIPERMTENRWSWSEVKYLSDSLLLALDASLEHALLGSLMTMDRYAAAESFYRLA
MAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGIVMQALVARNDGVWSKDHITA
LRKICPMVSNEISSETSAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELFHFCASILEL
VIPVYKSRRAYGQLSKCHTMLTNIYESILEQESSPIPFTDATYYRVGFYSDRFGKLDRKE
YVYREARDVRLGDIMEKLSHIYESRMDGNHTLHIIPDSRQVKADDLQPGVCYLQITAVDP
VMEDEDLGSRRERIFSLSTGSVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQTEG
SFPALVNRLLVTKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQSLQRI
LQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFRLIG
EEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5499 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacctgcggcctcgccgcgattccactccgtacacgaccaaatggcaaaacaag
tttgaggagaatttggagcagtggccgcatctgaaggagctggtacagtgctacacaaca
gactgggtgaaggatgagaacaagtatggtcactacgagagtgttggaccgtcgtcattt
cagaaccagatttatgagggtcctgacactgatattgagactgaaatgcacctttcaagt
gcaaggcgaaccaaggtggaagatactactgatgatgatgtcccaagtacctcgggacga
caatttatggatgctactgtatccgattcggtacactccaatgatccaaagcattttggt
caatcaccactccctgcttatgaaccagcttttgattgggaaaatgaaaggtcaatgata
tttggccaaagggttcccgaaacaccaatatctcatggattgaagatctcagtgaaagtt
ctgtccctatcgtttcaagcgggattagctgaaccattttacggaacaatttgcttatac
aatagggagagaagagaaaaactgtcagaggacttctattttcgtcatgcaccaaccgaa
aagaaggatatttcttttgaacctcgtggaatcttctatttggatgctccatcatcatcg
gtttgtctgctaatccagttagagaagcatgctacagaagaaggcggggttacgccttca
gtttattctcgtaaagaaccagtacacttgaccgagaaagaaaagcaaaaactgcaggtg
tggtctcaaataatgccttacagagagtccttcgcctgggccgttgtttcattatttgat
aacagcattggtgcagcttctggtgggtctgcttcaccaagcagtcctcttgctgctagt
atatctggttcaagctctcatgagggtgtgtttgagcctagtgcaaaggttacattagat
gggaagctaggttattcaagtcgaagctctgttgttgtcgaaatatcaaatttaaataaa
gtcaaagaatgctatactgaggactcacttcaggatcccaaacgcaagatccacaaacct
gtgaaaggtgttttgagacttgaaatcgagaagcaccagaatgaccatgttgacatggaa
aatatatcagaaagtggtagtgtgaccaatgattctattgatgatcgcataaccgattcc
acatttgggaagctcccaagtaatggtttggatggtcctcagggtagcagctctaagtgg
aattctttcgatgccaaagaaatatctggaaatggatcaaatgctcatggaaattcagtt
cccggttctgatgattttcaagctttcgacttccgtactacaacaagaaatgagcctttc
ttgcagctttttcattgtctgtatgtgtatcctatgactgttagtttaagtcggaagagg
aatttgttcataagagttgaacttcgggaggatgataatgatattcgtaggcagccttta
gaggcaatgtatccacgggagccaagtgcatcacttcagaagtgggctcacacacaattg
actgttggggcaagggtggcctgctaccatgatgaaataaagctctctctccctgccacc
tggacaccaacacatcatcttttatttactttttttcatgttgatcttcaaacaaaatta
gaagctccaaagccgatagtaattggatacgcggcacttccattatccacacatgctcag
ttgcgctctgaaatttctttgccaattatgagggagctggttccacattatctccaggat
atggccagagagaggttggattatttggaagatggaaagaatatatttcgattgcgctta
aggctttgttcgtcgttatatcctatcaatgagcgcataagagattttttccttgaatac
gataggcacactcttcgaacaagtgcaccttggggttctgaacttctggaggctattaac
agtttgaagaatgttgattccattgctttgcttcagtttcttcatccaattttgaatatg
cttctccatctaataggcaatggtggagaaaccctccaggttgcagcattcagagccatg
gttaatatcgtgacccgggtacagcaggagtcggttgatgatgctgaaagaaatcacttc
ctagttaactatgttgattatgcgtttgatgactttggaggtcgtcaaccaccagtttat
cctggtctgtcaactgtttggggaagcttggcccgtagtaaggctaaaggataccgtgtt
ggacctgtgtatgatgacgttttggcaatggcttggtttttccttgagctaattgtcaag
tcaatggcattggagaagatgcgtcttttctatcataatcttccattaggtgaagatatt
ccgcctatgcaattgaaagaaggtgtattcagatgtataatgcagttgtatgattgccta
ctaacagaagtgcatgaacgttgtaagaaaggattaagcttggcaaagcgtttaaacagc
agtttggctttcttttgttatgatctcttgtccatcatcgaacctcgccaagtttttgaa
ttggtgtccttgtacttggacaagttttctggggtatgtcaattggttctgcatgattgc
aagctcacatttttgcaaattatatgtgatcatgacctttttgtggaaatgcctgggaga
gacccttctgataggaactacctttcgtctgttctaatacaagagctatttcttacttgg
gatcatgatgatttatctctgcgggcaaaggcggctagaattttagtagtccttttgtgc
aagcatgagtttgatgctcgataccaaaagcccgaagataaactttatattgcgcagcta
tattttccacttatcggacagattctagatgaaatgcctgtgttttacaacctcaatgct
gttgaaaagcgtgaagttttagtcgctattttgcaaattgtccggaaccttgatgatgca
tcacttgtcaaggcgtggcagcaaagcattgctagaactagattatttttcaaactcatg
gaggaatgccttgttctatttgagcacagaaaacctgctgatggcatgcttatgggatct
agttctcgcagtcctgttggtgatggccctgcttcccccaagtattctgacagactctct
cctgcgatcaacaactatctgtctgaggcatctagacaagaagtcagacctcagggtaca
cctgaaaatgggtattcgtggcagagagtaaattctcagttaagctcccctagccagcca
tattccttaagggaagctctggctcaggcacaatcctctagaattggagcttctgcacaa
gcactaagagaatctttgcatccaattttgagacaaaaattggagctctgggaagaaaac
ttgagtgcttctgtcagtcttcaggttttggaaataactgagaagttttccacaatggca
gcatcccatagcatcgccactgactatggaaaatttgattgcgtcacagctatattcatg
agcttcttctctcgaaatcaaccattgtctttctggagatcactgcttcctgtcttcaac
agtgtcttcaatcttcatggtgcaaatttgatggcaagggaaaatgaccgttttttaaag
caagtcactttccatcttcttcgacttgctgtgtttcgaaatgataatatcagaaaaagg
gctgttatggggctccagatgcttataaggagttctttctactactttatgcagacagca
aggttgagggtcatgctgatcatcacattgtcagagttgatgtctgatgtacaagtgact
cagatgaagtctgatggaacactagaagagagtggtgaagccaggcgtcttcggcaatca
ctggaggaagtggcagatgcctctaagagcccgagtcttttgagagagtgtggacttcct
gagagtgctctgttagacattccagaaagaatgacagaaaatagatggtcctggtcagaa
gtgaagtatctctccgacagtcttcttcttgctcttgatgccagcttggaacacgcactc
ctgggctctttgatgactatggacagatatgcagctgcagaaagcttctatagactggct
atggcatttgcccctgtcccagatcttcacataatgtggttactgcatttatgtgatgca
catcaggaaatgcagtcttgggcagaagctgcccagtgtgctgttgctgtggctggtatt
gtaatgcaggcccttgtggcaagaaatgatggtgtttggagcaaagatcacataactgct
ctacgtaaaatttgtccaatggtcagcaatgagatcagctctgagacttctgcagctgag
gtagaaggatatggggcatcaaaacttactgttgactctgcagtgaagtacctacaactc
gcaaataagctattttctcaagctgaactctttcatttctgtgcaagcattctggaactc
gttatcccagtttacaaaagcaggagggcatatggacagctgagtaaatgtcacacgatg
cttactaatatctatgaatcaatacttgagcaggaatcaagtccaattccattcactgat
gcaacctactacagggttgggttttacagtgaccgatttggaaagttggatagaaaggaa
tatgtatacagggaggcccgtgatgtaaggctaggtgacataatggagaaacttagtcat
atatacgagtctaggatggatggcaatcacacgttacacattattccagattccaggcag
gtaaaggcagatgatttgcagcctggtgtctgctacctgcagataactgctgttgatcca
gtcatggaagatgaagatttgggaagcagaagggagagaatcttttctctttccactggt
agtgttcgtgcacgagtctttgatcgtttcttgtttgataccccatttacgaaaaatgga
aagactcaaggtggattggaagaccagtggaagaggcgaactgttcttcagactgaaggt
tcattcccagctcttgtgaataggcttttagttaccaaatcggaatcgcttgagttctcc
ccagtagaaaatgccattgggatgattgaaactcggacagctgccttacgaaatgaactt
gaagagcctcgcagttccgaaggggatcaactcccacgtctccagagcctacagagaatt
cttcaaggcagtgttgcagttcaggttaacagcggggtactgagtgtgtgcactgcattc
ctgtctggtgagcctgcaacaaggttgcggtcgcaggaactgcagcaactcattgccgcg
ctccttgaatttatggcggtatgcaagcgtgccatccgtgtacacttcagattgattggt
gaggaagatcaggagttccacacacagcttgtgaatggatttcaatctctaactgccgag
ttgtctcattacatccctgccattctgtcagagctgtga

DBGET integrated database retrieval system