KEGG   Prunus avium (sweet cherry): 110747005Help
Entry
110747005         CDS       T05161                                 

Definition
(RefSeq) polygalacturonase-like
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
pavi00040  Pentose and glucuronate interconversions
pavi01100  Metabolic pathways
Module
pavi_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:pavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110747005
Enzymes [BR:pavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     110747005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 VacA2
Motif
Other DBs
NCBI-GeneID: 110747005
NCBI-ProteinID: XP_021802911
Position
Unknown
AA seq 400 aa AA seqDB search
MAEVTTSCFSRVALLILYILHQSCVSESTLIFNVLSFGAKPNGVIDSTQAFLDVWTAACA
SSDSTTIRVPKGRYLLRNAMVFKGDNCKSTDITFRIDGTLIASSDYQILGQASNWLSFEG
VTGVSIIGGALDAKGTALWACKLAGSTDCPSGGATSLSFTNSKNININGLMSLNSQMFHI
VINGCQDVRIQGVKVSAAGNSPNTDGIHVQLSRNVAIFNTSIKTGDDCVSIGPGTKNLWI
EQITCGPGHGISIGSLAKDLEEEGVQNVTVKNAIFKGTQNGLRIKSWARPSNGFVEGVQF
LDVLMFNVQNPIVIDQNYCPHSINCPAQVSGVKISDVVYQNIQGTSASAVAIKFDCSATN
PCSGIRLENVSLTFRNQKVQSHCANANGKIVGTAQANSCL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggttacaacaagttgttttagcagagtagcactactcatcctatatatccta
caccaatcatgtgtttctgagagtacattaattttcaatgtcctaagctttggagccaag
cctaacggtgtaatagattctacacaagcttttctggatgtatggactgcagcatgcgcc
tcctctgattccactactatacgtgtaccaaaagggaggtatttgcttcgcaatgctatg
gtttttaaaggcgataactgcaaaagcacagatattacttttcggattgatggaacattg
atagcttcgtcggattaccaaatccttggccaagctagcaactggctaagcttcgaagga
gttactggtgtctccataatcggaggtgctcttgatgctaaaggtaccgccttgtgggca
tgcaagttagctggaagtaccgattgccccagcggaggagccacgagtctgagtttcaca
aactccaaaaacattaacatcaatggactaatgtcattgaacagccagatgttccacatt
gtgataaacggctgccaagatgttcgcatccaaggggtcaaagtcagtgcagcaggcaat
agcccaaacactgatggcatccatgtccaattgtcaagaaatgttgcaattttcaacaca
tccatcaaaactggagatgactgtgtctcgattggccccggaacaaagaacttgtggatc
gagcaaataacttgtggtcctggccatggcattagtatagggagtttggccaaagacttg
gaagaggaaggggtccaaaatgtgacagtgaaaaatgcaattttcaagggcactcaaaat
ggtttgaggattaagtcttgggcgaggccgagcaacgggtttgttgaaggtgttcaattc
cttgatgtcctaatgtttaatgtccaaaatcctattgtaatagaccaaaactactgcccg
cacagcatcaactgccccgctcaggtgtcgggtgtgaaaatcagtgatgtcgtgtaccag
aacattcaaggaacatcagcttcagcagttgcaataaaatttgattgtagcgcaacaaac
ccgtgcagtggaataagactcgaaaacgtgagtttaaccttcaggaatcaaaaggttcag
tcacattgtgccaatgcaaatggaaagattgttggcactgctcaagcaaatagttgtttg
taa

DBGET integrated database retrieval system